| UniProt ID | GBG3_HUMAN | |
|---|---|---|
| UniProt AC | P63215 | |
| Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 | |
| Gene Name | GNG3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 75 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
| Protein Sequence | MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MKGETPVNSTMS ---CCCCCCCCCCCC | 41.00 | 20886841 | |
| 9 | Phosphorylation | KGETPVNSTMSIGQA CCCCCCCCCCCHHHH | 26.22 | 22199227 | |
| 10 | Phosphorylation | GETPVNSTMSIGQAR CCCCCCCCCCHHHHH | 15.10 | 22199227 | |
| 12 | Phosphorylation | TPVNSTMSIGQARKM CCCCCCCCHHHHHHH | 24.53 | 22199227 | |
| 24 | "N6,N6-dimethyllysine" | RKMVEQLKIEASLCR HHHHHHHHHHHHHHC | 37.89 | - | |
| 24 | Methylation | RKMVEQLKIEASLCR HHHHHHHHHHHHHHC | 37.89 | 23644510 | |
| 33 | Ubiquitination | EASLCRIKVSKAAAD HHHHHCHHHCHHHHH | 22.54 | 32015554 | |
| 36 | Ubiquitination | LCRIKVSKAAADLMT HHCHHHCHHHHHHHH | 45.06 | 32142685 | |
| 72 | Methylation | FREKKFFCALL---- CHHHCCHHCCC---- | 2.69 | - | |
| 72 | Geranylgeranylation | FREKKFFCALL---- CHHHCCHHCCC---- | 2.69 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GNB5_HUMAN | GNB5 | physical | 8636150 | |
| GBB1_HUMAN | GNB1 | physical | 8636150 | |
| GBB2_HUMAN | GNB2 | physical | 8636150 | |
| GBB3_HUMAN | GNB3 | physical | 8636150 | |
| GBB4_HUMAN | GNB4 | physical | 8636150 | |
| GBB1_HUMAN | GNB1 | physical | 19168127 | |
| GBB2_HUMAN | GNB2 | physical | 19168127 | |
| GBB3_HUMAN | GNB3 | physical | 19168127 | |
| GNAT2_HUMAN | GNAT2 | physical | 28514442 | |
| GNAQ_HUMAN | GNAQ | physical | 28514442 | |
| GNAO_HUMAN | GNAO1 | physical | 28514442 | |
| GNA13_HUMAN | GNA13 | physical | 28514442 | |
| GBB4_HUMAN | GNB4 | physical | 28514442 | |
| GNAZ_HUMAN | GNAZ | physical | 28514442 | |
| GNA11_HUMAN | GNA11 | physical | 28514442 | |
| FLNC_HUMAN | FLNC | physical | 28514442 | |
| GBB1_HUMAN | GNB1 | physical | 28514442 | |
| GNAI2_HUMAN | GNAI2 | physical | 28514442 | |
| GNAI1_HUMAN | GNAI1 | physical | 28514442 | |
| PHLP_HUMAN | PDCL | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...