UniProt ID | GBG3_HUMAN | |
---|---|---|
UniProt AC | P63215 | |
Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 | |
Gene Name | GNG3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 75 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
Protein Sequence | MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MKGETPVNSTMS ---CCCCCCCCCCCC | 41.00 | 20886841 | |
9 | Phosphorylation | KGETPVNSTMSIGQA CCCCCCCCCCCHHHH | 26.22 | 22199227 | |
10 | Phosphorylation | GETPVNSTMSIGQAR CCCCCCCCCCHHHHH | 15.10 | 22199227 | |
12 | Phosphorylation | TPVNSTMSIGQARKM CCCCCCCCHHHHHHH | 24.53 | 22199227 | |
24 | "N6,N6-dimethyllysine" | RKMVEQLKIEASLCR HHHHHHHHHHHHHHC | 37.89 | - | |
24 | Methylation | RKMVEQLKIEASLCR HHHHHHHHHHHHHHC | 37.89 | 23644510 | |
33 | Ubiquitination | EASLCRIKVSKAAAD HHHHHCHHHCHHHHH | 22.54 | 32015554 | |
36 | Ubiquitination | LCRIKVSKAAADLMT HHCHHHCHHHHHHHH | 45.06 | 32142685 | |
72 | Methylation | FREKKFFCALL---- CHHHCCHHCCC---- | 2.69 | - | |
72 | Geranylgeranylation | FREKKFFCALL---- CHHHCCHHCCC---- | 2.69 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNB5_HUMAN | GNB5 | physical | 8636150 | |
GBB1_HUMAN | GNB1 | physical | 8636150 | |
GBB2_HUMAN | GNB2 | physical | 8636150 | |
GBB3_HUMAN | GNB3 | physical | 8636150 | |
GBB4_HUMAN | GNB4 | physical | 8636150 | |
GBB1_HUMAN | GNB1 | physical | 19168127 | |
GBB2_HUMAN | GNB2 | physical | 19168127 | |
GBB3_HUMAN | GNB3 | physical | 19168127 | |
GNAT2_HUMAN | GNAT2 | physical | 28514442 | |
GNAQ_HUMAN | GNAQ | physical | 28514442 | |
GNAO_HUMAN | GNAO1 | physical | 28514442 | |
GNA13_HUMAN | GNA13 | physical | 28514442 | |
GBB4_HUMAN | GNB4 | physical | 28514442 | |
GNAZ_HUMAN | GNAZ | physical | 28514442 | |
GNA11_HUMAN | GNA11 | physical | 28514442 | |
FLNC_HUMAN | FLNC | physical | 28514442 | |
GBB1_HUMAN | GNB1 | physical | 28514442 | |
GNAI2_HUMAN | GNAI2 | physical | 28514442 | |
GNAI1_HUMAN | GNAI1 | physical | 28514442 | |
PHLP_HUMAN | PDCL | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...