UniProt ID | GNAT2_HUMAN | |
---|---|---|
UniProt AC | P19087 | |
Protein Name | Guanine nucleotide-binding protein G(t) subunit alpha-2 | |
Gene Name | GNAT2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 354 | |
Subcellular Localization | ||
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.. | |
Protein Sequence | MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGSGASAED ------CCCCCCHHH | 34.48 | - | |
3 | Phosphorylation | -----MGSGASAEDK -----CCCCCCHHHH | 29.86 | 24719451 | |
6 | Phosphorylation | --MGSGASAEDKELA --CCCCCCHHHHHHH | 35.40 | 24719451 | |
17 | Acetylation | KELAKRSKELEKKLQ HHHHHHHHHHHHHHH | 71.05 | 30588951 | |
21 | Acetylation | KRSKELEKKLQEDAD HHHHHHHHHHHHHHH | 71.99 | 30588957 | |
35 | Acetylation | DKEAKTVKLLLLGAG HHHHHHHHHHHHCCC | 38.35 | 7219281 | |
44 | Phosphorylation | LLLGAGESGKSTIVK HHHCCCCCCCCHHHH | 51.07 | 20873877 | |
46 | Ubiquitination | LGAGESGKSTIVKQM HCCCCCCCCHHHHEE | 54.42 | 21890473 | |
47 | Phosphorylation | GAGESGKSTIVKQMK CCCCCCCCHHHHEEE | 27.22 | 20873877 | |
48 | Phosphorylation | AGESGKSTIVKQMKI CCCCCCCHHHHEEEE | 33.02 | 29514088 | |
51 | Ubiquitination | SGKSTIVKQMKIIHQ CCCCHHHHEEEEECC | 40.60 | 21906983 | |
95 | Phosphorylation | MTTLGIDYAEPSCAD HHHCCCCCCCCCCCC | 15.79 | - | |
178 | ADP-ribosylation | EQDVLRSRVKTTGII HHHHHHHHHCCCCEE | 27.76 | - | |
178 | ADP-ribosylation | EQDVLRSRVKTTGII HHHHHHHHHCCCCEE | 27.76 | - | |
192 | Ubiquitination | IETKFSVKDLNFRMF EEEEEEECCCCEEEE | 56.13 | - | |
206 | Phosphorylation | FDVGGQRSERKKWIH EECCCCCCCCHHHHH | 33.59 | 23401153 | |
271 | Ubiquitination | IVLFLNKKDLFEEKI HHHHHCCHHHHHHHH | 59.60 | - | |
321 | Phosphorylation | KDVKEIYSHMTCATD CCHHHHHHHCCCCCC | 16.67 | 22210691 | |
324 | Phosphorylation | KEIYSHMTCATDTQN HHHHHHCCCCCCCCC | 8.12 | 30576142 | |
327 | Phosphorylation | YSHMTCATDTQNVKF HHHCCCCCCCCCCCC | 41.55 | 22210691 | |
329 | Phosphorylation | HMTCATDTQNVKFVF HCCCCCCCCCCCCHH | 20.07 | 30576142 | |
351 | ADP-ribosylation | IKENLKDCGLF---- HHHHHCCCCCC---- | 4.95 | - | |
351 | ADP-ribosylation | IKENLKDCGLF---- HHHHHCCCCCC---- | 4.95 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNAT2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNAT2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNAT2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
U119A_HUMAN | UNC119 | physical | 26186194 | |
U119B_HUMAN | UNC119B | physical | 26186194 | |
ACSL3_HUMAN | ACSL3 | physical | 26186194 | |
ACSL4_HUMAN | ACSL4 | physical | 26186194 | |
SNX1_HUMAN | SNX1 | physical | 26186194 | |
SNX2_HUMAN | SNX2 | physical | 26186194 | |
SNX5_HUMAN | SNX5 | physical | 26186194 | |
VP13A_HUMAN | VPS13A | physical | 26186194 | |
OCAD1_HUMAN | OCIAD1 | physical | 26186194 | |
EPHA4_HUMAN | EPHA4 | physical | 26186194 | |
ARMX3_HUMAN | ARMCX3 | physical | 26186194 | |
ACSL4_HUMAN | ACSL4 | physical | 28514442 | |
OCAD1_HUMAN | OCIAD1 | physical | 28514442 | |
SNX5_HUMAN | SNX5 | physical | 28514442 | |
U119A_HUMAN | UNC119 | physical | 28514442 | |
ACSL3_HUMAN | ACSL3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
613856 | Achromatopsia 4 (ACHM4) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...