UniProt ID | U119B_HUMAN | |
---|---|---|
UniProt AC | A6NIH7 | |
Protein Name | Protein unc-119 homolog B | |
Gene Name | UNC119B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 251 | |
Subcellular Localization | Cell projection, cilium . Enriched at the transition zone and extended into the proximal end of the cilium. | |
Protein Description | Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated NPHP3 and plays a key role in localization of NPHP3 to the primary cilium membrane. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells.. | |
Protein Sequence | MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGSNPKAA ------CCCCCHHHH | 51.43 | 22814378 | |
24 | Acetylation | PGGLVAGKEEKKKAG CCCEECCHHHHHHCC | 53.62 | 19608861 | |
27 | Acetylation | LVAGKEEKKKAGGGV EECCHHHHHHCCCHH | 61.74 | 18585049 | |
29 | Ubiquitination | AGKEEKKKAGGGVLN CCHHHHHHCCCHHHH | 64.43 | - | |
86 | Ubiquitination | VTENYLCKPEDNIYS CCCCEEECCCCCEEE | 49.17 | - | |
92 | Phosphorylation | CKPEDNIYSIDFTRF ECCCCCEEEEECEEE | 13.06 | 27642862 | |
106 | Phosphorylation | FKIRDLETGTVLFEI EEEEECCCCCEEEEE | 45.51 | 28122231 | |
108 | Phosphorylation | IRDLETGTVLFEIAK EEECCCCCEEEEEEC | 22.81 | 28122231 | |
119 | Phosphorylation | EIAKPCVSDQEEDEE EEECCCCCCCCHHHH | 40.05 | 28464451 | |
205 | Phosphorylation | RNTCEHIYEFPQLSE CCCCHHHHCCCCCCH | 17.27 | 27642862 | |
229 | Phosphorylation | PYETRSDSFYFVDNK CCCCCCCCEEEECCE | 24.08 | 27499020 | |
242 | Ubiquitination | NKLIMHNKADYAYNG CEEEEECCCCCCCCC | 28.14 | - | |
245 | Phosphorylation | IMHNKADYAYNGGQ- EEECCCCCCCCCCC- | 18.82 | 29496907 | |
247 | Phosphorylation | HNKADYAYNGGQ--- ECCCCCCCCCCC--- | 14.22 | 29496907 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of U119B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of U119B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of U119B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBAC1_HUMAN | UBAC1 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-24, AND MASS SPECTROMETRY. |