dbPTM

FUCM_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FUCM_HUMAN
UniProt AC	A2VDF0
Protein Name	Fucose mutarotase
Gene Name	FUOM
Organism	Homo sapiens (Human).
Sequence Length	154
Subcellular Localization
Protein Description	Involved in the interconversion between alpha- and beta-L-fucoses. L-Fucose (6-deoxy-L-galactose) exists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%), the beta-form is metabolized through the salvage pathway. GDP-L-fucose formed either by the de novo or salvage pathways is transported into the endoplasmic reticulum, where it serves as a substrate for N- and O-glycosylations by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are believed to play a critical role in cell-cell adhesion and recognition processes..
Protein Sequence	MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGNLILRKGVLALNPLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
5	Ubiquitination	---MVALKGVPALLS ---CCCCCCCCCCCC	48.39	-
74	Phosphorylation	PLDTYVESPAAVMEL CCCCCCCCCCHHHHC	15.14	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FUCM_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FUCM_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FUCM_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AFAD_HUMAN	MLLT4	physical	28514442
EEA1_HUMAN	EEA1	physical	28514442
PRRC1_HUMAN	PRRC1	physical	28514442
TOM34_HUMAN	TOMM34	physical	28514442
F10C1_HUMAN	FRA10AC1	physical	28514442
EF1A2_HUMAN	EEF1A2	physical	28514442
GPAM1_HUMAN	GPALPP1	physical	28514442
GOGA3_HUMAN	GOLGA3	physical	28514442
PKN1_HUMAN	PKN1	physical	28514442
RBM27_HUMAN	RBM27	physical	28514442
RN123_HUMAN	RNF123	physical	28514442
DDX46_HUMAN	DDX46	physical	28514442
PRC2A_HUMAN	PRRC2A	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FUCM_HUMAN

Related Literatures of Post-Translational Modification