UniProt ID | FUCM_HUMAN | |
---|---|---|
UniProt AC | A2VDF0 | |
Protein Name | Fucose mutarotase | |
Gene Name | FUOM | |
Organism | Homo sapiens (Human). | |
Sequence Length | 154 | |
Subcellular Localization | ||
Protein Description | Involved in the interconversion between alpha- and beta-L-fucoses. L-Fucose (6-deoxy-L-galactose) exists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%), the beta-form is metabolized through the salvage pathway. GDP-L-fucose formed either by the de novo or salvage pathways is transported into the endoplasmic reticulum, where it serves as a substrate for N- and O-glycosylations by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are believed to play a critical role in cell-cell adhesion and recognition processes.. | |
Protein Sequence | MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGNLILRKGVLALNPLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FUCM_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FUCM_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FUCM_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AFAD_HUMAN | MLLT4 | physical | 28514442 | |
EEA1_HUMAN | EEA1 | physical | 28514442 | |
PRRC1_HUMAN | PRRC1 | physical | 28514442 | |
TOM34_HUMAN | TOMM34 | physical | 28514442 | |
F10C1_HUMAN | FRA10AC1 | physical | 28514442 | |
EF1A2_HUMAN | EEF1A2 | physical | 28514442 | |
GPAM1_HUMAN | GPALPP1 | physical | 28514442 | |
GOGA3_HUMAN | GOLGA3 | physical | 28514442 | |
PKN1_HUMAN | PKN1 | physical | 28514442 | |
RBM27_HUMAN | RBM27 | physical | 28514442 | |
RN123_HUMAN | RNF123 | physical | 28514442 | |
DDX46_HUMAN | DDX46 | physical | 28514442 | |
PRC2A_HUMAN | PRRC2A | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...