FCN1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FCN1_HUMAN
• UniProt AC: O00602
• Protein Name: Ficolin-1
• Gene Name: FCN1
• Organism: Homo sapiens (Human).
• Sequence Length: 326
• Subcellular Localization: Secreted . Cell membrane ; Peripheral membrane protein ; Extracellular side . Found on the monocyte and granulocyte surface (PubMed:20400674).
• Protein Description: Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8. [PubMed: 21037097 Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage.]
• Protein Sequence: MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Phosphorylation	GDAGQSQSCATGPRN CCCCCCCCCCCCCCC	15.80	29083192
113	Phosphorylation	GQSQSCATGPRNCKD CCCCCCCCCCCCHHH	52.63	29083192
197	Phosphorylation	NDNIHALTAQGSSEL CCCEEEEECCCCCEE	20.09	24043423
201	Phosphorylation	HALTAQGSSELRVDL EEEECCCCCEEEEEE	14.46	24043423
202	Phosphorylation	ALTAQGSSELRVDLV EEECCCCCEEEEEEE	47.69	24043423
305	N-linked_Glycosylation	ESYANGINWSAAKGY HHHCCCCCHHHCCCC	28.22	UniProtKB CARBOHYD
312	Phosphorylation	NWSAAKGYKYSYKVS CHHHCCCCCEEEEEE	13.17	24719451
319	Phosphorylation	YKYSYKVSEMKVRPA CCEEEEEEEEEEECC	28.02	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FCN1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FCN1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FCN1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELN_HUMAN	ELN	physical	8947836
K319L_HUMAN	KIAA0319L	physical	26186194
DJC13_HUMAN	DNAJC13	physical	26186194
PTPRA_HUMAN	PTPRA	physical	26186194
POTEF_HUMAN	POTEF	physical	26186194
GT252_HUMAN	COLGALT2	physical	26186194
PTPRG_HUMAN	PTPRG	physical	26186194
PODXL_HUMAN	PODXL	physical	26186194
FCN2_HUMAN	FCN2	physical	26186194
SUSD5_HUMAN	SUSD5	physical	26186194
FBLN1_HUMAN	FBLN1	physical	26186194
SE6L2_HUMAN	SEZ6L2	physical	26186194
K1549_HUMAN	KIAA1549	physical	26186194
FCN2_HUMAN	FCN2	physical	28514442
SUSD5_HUMAN	SUSD5	physical	28514442
SE6L2_HUMAN	SEZ6L2	physical	28514442
PODXL_HUMAN	PODXL	physical	28514442
DJC13_HUMAN	DNAJC13	physical	28514442
K319L_HUMAN	KIAA0319L	physical	28514442
PTPRA_HUMAN	PTPRA	physical	28514442
PTPRG_HUMAN	PTPRG	physical	28514442
K1549_HUMAN	KIAA1549	physical	28514442
POTEF_HUMAN	POTEF	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.