UniProt ID | FCN2_HUMAN | |
---|---|---|
UniProt AC | Q15485 | |
Protein Name | Ficolin-2 | |
Gene Name | FCN2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 313 | |
Subcellular Localization | Secreted. | |
Protein Description | May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.. | |
Protein Sequence | MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
77 | Hydroxylation | KRGERGPPGPPGKAG CCCCCCCCCCCCCCC | 71.41 | 8586615 | |
80 | Hydroxylation | ERGPPGPPGKAGPPG CCCCCCCCCCCCCCC | 63.93 | 8586615 | |
86 | Hydroxylation | PPGKAGPPGPNGAPG CCCCCCCCCCCCCCC | 70.70 | 8586615 | |
168 | Phosphorylation | TYKQGFGSRLGEFWL HHHHCCCCCCEEEEC | 23.28 | 24505115 | |
240 | N-linked_Glycosylation | DSLTFHNNQSFSTKD CCEEEECCCCCCCCC | 30.24 | 17215869 | |
300 | N-linked_Glycosylation | WKSGKGYNYSYKVSE CCCCCCCCCEEEEEE | 28.13 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FCN2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FCN2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FCN2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FCN2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...