UniProt ID | FBRL_MOUSE | |
---|---|---|
UniProt AC | P35550 | |
Protein Name | rRNA 2'-O-methyltransferase fibrillarin | |
Gene Name | Fbl | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 327 | |
Subcellular Localization | Nucleus, nucleolus. Fibrillar region of the nucleolus. | |
Protein Description | S-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins. Involved in pre-rRNA processing by catalyzing the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Also acts as a protein methyltransferase by mediating methylation of 'Gln-105' of histone H2A (H2AQ104me), a modification that impairs binding of the FACT complex and is specifically present at 35S ribosomal DNA locus (By similarity).. | |
Protein Sequence | MKPGFSPRGGGFGGRGGFGDRGGRGGGRGGRGGFGGGRGGFGGGGRGRGGGGGGFRGRGGGGGRGGGFQSGGNRGRGGGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Asymmetric dimethylarginine | MKPGFSPRGGGFGGR CCCCCCCCCCCCCCC | 56.01 | - | |
8 | Methylation | MKPGFSPRGGGFGGR CCCCCCCCCCCCCCC | 56.01 | - | |
15 | Asymmetric dimethylarginine | RGGGFGGRGGFGDRG CCCCCCCCCCCCCCC | 42.30 | - | |
15 | Methylation | RGGGFGGRGGFGDRG CCCCCCCCCCCCCCC | 42.30 | - | |
21 | Asymmetric dimethylarginine | GRGGFGDRGGRGGGR CCCCCCCCCCCCCCC | 50.25 | - | |
21 | Methylation | GRGGFGDRGGRGGGR CCCCCCCCCCCCCCC | 50.25 | - | |
24 | Asymmetric dimethylarginine | GFGDRGGRGGGRGGR CCCCCCCCCCCCCCC | 43.33 | - | |
24 | Methylation | GFGDRGGRGGGRGGR CCCCCCCCCCCCCCC | 43.33 | - | |
28 | Asymmetric dimethylarginine | RGGRGGGRGGRGGFG CCCCCCCCCCCCCCC | 47.90 | - | |
28 | Methylation | RGGRGGGRGGRGGFG CCCCCCCCCCCCCCC | 47.90 | - | |
31 | Methylation | RGGGRGGRGGFGGGR CCCCCCCCCCCCCCC | 44.90 | - | |
31 | Asymmetric dimethylarginine | RGGGRGGRGGFGGGR CCCCCCCCCCCCCCC | 44.90 | - | |
38 | Methylation | RGGFGGGRGGFGGGG CCCCCCCCCCCCCCC | 45.39 | - | |
46 | Methylation | GGFGGGGRGRGGGGG CCCCCCCCCCCCCCC | 34.60 | - | |
48 | Dimethylation | FGGGGRGRGGGGGGF CCCCCCCCCCCCCCC | 38.94 | - | |
64 | Methylation | GRGGGGGRGGGFQSG CCCCCCCCCCCCCCC | 43.81 | - | |
88 | Phosphorylation | GGKRGNQSGKNVMVE CCCCCCCCCCCEEEC | 56.59 | 25890499 | |
108 | Ubiquitination | GVFICRGKEDALVTK CEEEECCCCCEEEEC | 32.82 | 27667366 | |
108 | Malonylation | GVFICRGKEDALVTK CEEEECCCCCEEEEC | 32.82 | 26320211 | |
108 | Acetylation | GVFICRGKEDALVTK CEEEECCCCCEEEEC | 32.82 | 23806337 | |
115 | Ubiquitination | KEDALVTKNLVPGES CCCEEEECCCCCCCC | 40.58 | 22790023 | |
122 | Phosphorylation | KNLVPGESVYGEKRV CCCCCCCCCCCCCEE | 26.93 | 29176673 | |
124 | Phosphorylation | LVPGESVYGEKRVSI CCCCCCCCCCCEEEE | 28.93 | - | |
127 | Ubiquitination | GESVYGEKRVSISEG CCCCCCCCEEEECCC | 54.45 | 22790023 | |
127 | Acetylation | GESVYGEKRVSISEG CCCCCCCCEEEECCC | 54.45 | 23236377 | |
130 | Phosphorylation | VYGEKRVSISEGDDK CCCCCEEEECCCCCC | 25.16 | 27087446 | |
132 | Phosphorylation | GEKRVSISEGDDKIE CCCEEEECCCCCCEE | 28.20 | 22942356 | |
137 | Acetylation | SISEGDDKIEYRAWN EECCCCCCEEEEECC | 42.02 | 23806337 | |
137 | Ubiquitination | SISEGDDKIEYRAWN EECCCCCCEEEEECC | 42.02 | 22790023 | |
140 | Phosphorylation | EGDDKIEYRAWNPFR CCCCCEEEEECCHHH | 14.76 | 25619855 | |
164 | Ubiquitination | GVDQIHIKPGAKVLY CCCEEEECCCCEEEE | 24.20 | 22790023 | |
171 | Phosphorylation | KPGAKVLYLGAASGT CCCCEEEEEECCCCC | 13.18 | 19854140 | |
176 | Phosphorylation | VLYLGAASGTTVSHV EEEEECCCCCCEEEH | 35.82 | 19854140 | |
178 | Phosphorylation | YLGAASGTTVSHVSD EEECCCCCCEEEHHH | 22.87 | 19854140 | |
199 | Phosphorylation | LVYAVEFSHRSGRDL EEEEEEEECCCCHHH | 12.41 | 19854140 | |
211 | Acetylation | RDLINLAKKRTNIIP HHHHHHHHHHCCEEC | 46.05 | 23236377 | |
212 | Acetylation | DLINLAKKRTNIIPV HHHHHHHHHCCEECC | 59.87 | - | |
287 | Phosphorylation | SAEAVFASEVKKMQQ CHHHHHHHHHHHHHH | 31.30 | 28542873 | |
298 | Acetylation | KMQQENMKPQEQLTL HHHHHCCCHHHHCCC | 55.95 | 22826441 | |
298 | Ubiquitination | KMQQENMKPQEQLTL HHHHHCCCHHHHCCC | 55.95 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FBRL_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
105 | Q | Acetylation |
| - |
105 | Q | Acetylation |
| - |
105 | Q | Methylation |
| - |
105 | Q | Methylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FBRL_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ABCF1_HUMAN | ABCF1 | physical | 26496610 | |
DHC24_HUMAN | DHCR24 | physical | 26496610 | |
FLNB_HUMAN | FLNB | physical | 26496610 | |
HELLS_HUMAN | HELLS | physical | 26496610 | |
HMGA1_HUMAN | HMGA1 | physical | 26496610 | |
DNJA1_HUMAN | DNAJA1 | physical | 26496610 | |
IF16_HUMAN | IFI16 | physical | 26496610 | |
RLA0_HUMAN | RPLP0 | physical | 26496610 | |
RS27_HUMAN | RPS27 | physical | 26496610 | |
COIL_HUMAN | COIL | physical | 26496610 | |
CAF1B_HUMAN | CHAF1B | physical | 26496610 | |
BECN1_HUMAN | BECN1 | physical | 26496610 | |
U3IP2_HUMAN | RRP9 | physical | 26496610 | |
ANM5_HUMAN | PRMT5 | physical | 26496610 | |
NOP56_HUMAN | NOP56 | physical | 26496610 | |
CSN8_HUMAN | COPS8 | physical | 26496610 | |
STIP1_HUMAN | STIP1 | physical | 26496610 | |
SO4A1_HUMAN | SLCO4A1 | physical | 26496610 | |
RT02_HUMAN | MRPS2 | physical | 26496610 | |
NOP58_HUMAN | NOP58 | physical | 26496610 | |
PINX1_HUMAN | PINX1 | physical | 26496610 | |
MEP50_HUMAN | WDR77 | physical | 26496610 | |
RIOK1_HUMAN | RIOK1 | physical | 26496610 | |
LSM11_HUMAN | LSM11 | physical | 26496610 | |
H3C_HUMAN | H3F3C | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, AND MASSSPECTROMETRY. |