dbPTM

ESC_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ESC_DROME
UniProt AC	Q24338
Protein Name	Polycomb protein esc
Gene Name	esc
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	425
Subcellular Localization	Nucleus .
Protein Description	Polycomb group (PcG) protein. While PcG proteins are generally required to maintain the transcriptionally repressive state of homeotic genes throughout development, this protein is specifically required during the first 6 hours of embryogenesis to establish the repressed state. Component of the Esc/E(z) complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3, leading to transcriptional repression of the affected target gene. The Esc/E(z) complex is necessary but not sufficient for the repression of homeotic target genes, suggesting that the recruitment of the distinct PRC1 complex is also required..
Protein Sequence	MSSDKVKNGNEPEESEESCGDESASYTTNSTTSRSKSPSSSTRSKRRGRRSTKSKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVFATAGSNRVTVYECPRQGGMQLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWELDPSDPEGAHMTTLHNSRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRQTTSI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	NGNEPEESEESCGDE CCCCCHHHHHCCCCC	45.03	22817900
18	Phosphorylation	EPEESEESCGDESAS CCHHHHHCCCCCCCC	21.24	22817900
35	Phosphorylation	TNSTTSRSKSPSSST CCCCCCCCCCCCCCC	36.93	19429919
37	Phosphorylation	STTSRSKSPSSSTRS CCCCCCCCCCCCCCH	31.12	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ESC_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ESC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ESC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF12_DROME	Taf12	physical	14605208
PCL_DROME	Pcl	physical	12697833
SUZ12_DROME	Su(z)12	physical	12697833
EZ_DROME	E(z)	physical	12697833
HDAC1_DROME	Rpd3	physical	12697833
EZ_DROME	E(z)	physical	11124122
HDAC1_DROME	Rpd3	physical	11124122
CAF1_DROME	Caf1	physical	11124122
EZ_DROME	E(z)	physical	17210640
ESC_DROME	esc	physical	15896722
PCL_DROME	Pcl	physical	15896722
HDAC1_DROME	Rpd3	physical	15896722
SUZ12_DROME	Su(z)12	physical	15896722
EZ_DROME	E(z)	physical	15896722
EZ_DROME	E(z)	physical	9566901
SUZ12_DROME	Su(z)12	physical	12408864
EZ_DROME	E(z)	physical	12408864
CAF1_DROME	Caf1	physical	12408864
ESC_DROME	esc	physical	12408864
TRX_DROME	trx	genetic	15031712
PIWI_DROME	piwi	physical	26780607
ESC_DROME	esc	physical	11124122
PCL_DROME	Pcl	physical	11571280
EZ_DROME	E(z)	physical	25242320
EZ_DROME	E(z)	physical	10757791
EZ_DROME	E(z)	physical	11571280
EZ_DROME	E(z)	physical	11581156
EZ_DROME	E(z)	physical	15776017
EZ_DROME	E(z)	physical	16618800
EZ_DROME	E(z)	physical	24100017
EZ_DROME	E(z)	physical	26063573
EZ_DROME	E(z)	physical	9693151
EZ_DROME	E(z)	physical	12408863
EZ_DROME	E(z)	physical	22923582
PC_DROME	Pc	physical	11581156
CORTO_DROME	corto	physical	12771214
SCM_DROME	Scm	physical	26063573
CAF1_DROME	Caf1	physical	24100017
CAF1_DROME	Caf1	physical	26063573
PHO_DROME	pho	physical	11581156
PHO_DROME	pho	physical	15175158
SUZ12_DROME	Su(z)12	physical	25242320
SUZ12_DROME	Su(z)12	physical	24100017
SUZ12_DROME	Su(z)12	physical	26063573
SUZ12_DROME	Su(z)12	physical	12408863
SUZ12_DROME	Su(z)12	physical	22923582

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ESC_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-15, AND MASSSPECTROMETRY.	18327897 [Abstract]