UniProt ID | EIF1B_HUMAN | |
---|---|---|
UniProt AC | O60739 | |
Protein Name | Eukaryotic translation initiation factor 1b | |
Gene Name | EIF1B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 113 | |
Subcellular Localization | ||
Protein Description | Probably involved in translation.. | |
Protein Sequence | MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTIQNLQS ------CCCCCCHHH | 33.93 | 23186163 | |
2 | Acetylation | ------MSTIQNLQS ------CCCCCCHHH | 33.93 | 21406692 | |
3 | Phosphorylation | -----MSTIQNLQSF -----CCCCCCHHHC | 25.86 | 27251275 | |
9 | Phosphorylation | STIQNLQSFDPFADA CCCCCHHHCCCCCCC | 34.48 | 23663014 | |
17 | Phosphorylation | FDPFADATKGDDLLP CCCCCCCCCCCCCCC | 35.79 | 26270265 | |
18 | Ubiquitination | DPFADATKGDDLLPA CCCCCCCCCCCCCCC | 63.16 | - | |
27 | Phosphorylation | DDLLPAGTEDYIHIR CCCCCCCCCCEEEEE | 27.99 | 27732954 | |
30 | Phosphorylation | LPAGTEDYIHIRIQQ CCCCCCCEEEEEEEE | 6.54 | 25159151 | |
42 | Ubiquitination | IQQRNGRKTLTTVQG EEECCCCEEEEEEEC | 49.65 | - | |
42 | Malonylation | IQQRNGRKTLTTVQG EEECCCCEEEEEEEC | 49.65 | 26320211 | |
43 | Phosphorylation | QQRNGRKTLTTVQGI EECCCCEEEEEEECC | 28.16 | 22199227 | |
45 | Phosphorylation | RNGRKTLTTVQGIAD CCCCEEEEEEECCCC | 30.10 | 20068231 | |
46 | Phosphorylation | NGRKTLTTVQGIADD CCCEEEEEEECCCCC | 17.59 | 28555341 | |
54 | Phosphorylation | VQGIADDYDKKKLVK EECCCCCCCHHHHHH | 30.15 | 20068231 | |
56 | Acetylation | GIADDYDKKKLVKAF CCCCCCCHHHHHHHH | 45.65 | 25953088 | |
58 | Acetylation | ADDYDKKKLVKAFKK CCCCCHHHHHHHHHH | 65.34 | 19608861 | |
61 | Acetylation | YDKKKLVKAFKKKFA CCHHHHHHHHHHHHC | 59.55 | 26051181 | |
65 | Acetylation | KLVKAFKKKFACNGT HHHHHHHHHHCCCCE | 46.82 | 25953088 | |
66 | Ubiquitination | LVKAFKKKFACNGTV HHHHHHHHHCCCCEE | 38.49 | - | |
66 | Acetylation | LVKAFKKKFACNGTV HHHHHHHHHCCCCEE | 38.49 | 25953088 | |
72 | Phosphorylation | KKFACNGTVIEHPEY HHHCCCCEEEECCCC | 12.34 | 27307780 | |
79 | Phosphorylation | TVIEHPEYGEVIQLQ EEEECCCCCCEEEEC | 24.04 | 27307780 | |
91 | Ubiquitination | QLQGDQRKNICQFLL EECCHHHHCHHHHHH | 45.06 | 21890473 | |
104 | Sumoylation | LLEVGIVKEEQLKVH HHHCCCCCHHHCCCC | 54.32 | - | |
104 | Sumoylation | LLEVGIVKEEQLKVH HHHCCCCCHHHCCCC | 54.32 | - | |
109 | Ubiquitination | IVKEEQLKVHGF--- CCCHHHCCCCCC--- | 31.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EIF1B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EIF1B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EIF1B_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-58 AND LYS-61, AND MASSSPECTROMETRY. |