UniProt ID | IF2G_HUMAN | |
---|---|---|
UniProt AC | P41091 | |
Protein Name | Eukaryotic translation initiation factor 2 subunit 3 | |
Gene Name | EIF2S3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 472 | |
Subcellular Localization | ||
Protein Description | As a subunit of eukaryotic initiation factor 2 (eIF2), involved in the early steps of protein synthesis. In the presence of GTP, eIF2 forms a ternary complex with initiator tRNA Met-tRNAi and then recruits the 40S ribosomal complex, a step that determines the rate of protein translation. This step is followed by mRNA binding to form the 43S pre-initiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF2 and release of an eIF2-GDP binary complex. In order for eIF2 to recycle and catalyze another round of initiation, the GDP bound to eIF2 must exchange with GTP by way of a reaction catalyzed by eIF2B (By similarity). Along with its paralog on chromosome Y, may contribute to spermatogenesis up to the round spermatid stage (By similarity).. | |
Protein Sequence | MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGGEAGVT ------CCCCCCCCC | 34.40 | - | |
9 | Phosphorylation | AGGEAGVTLGQPHLS CCCCCCCCCCCCCCC | 25.01 | 30108239 | |
16 | Phosphorylation | TLGQPHLSRQDLTTL CCCCCCCCCCCCCCC | 25.51 | 29255136 | |
21 | Phosphorylation | HLSRQDLTTLDVTKL CCCCCCCCCCCCCCC | 33.33 | 26657352 | |
22 | Phosphorylation | LSRQDLTTLDVTKLT CCCCCCCCCCCCCCC | 28.40 | 30576142 | |
26 | Phosphorylation | DLTTLDVTKLTPLSH CCCCCCCCCCCCCCH | 21.72 | 30108239 | |
27 | Ubiquitination | LTTLDVTKLTPLSHE CCCCCCCCCCCCCHH | 50.65 | 27667366 | |
27 | 2-Hydroxyisobutyrylation | LTTLDVTKLTPLSHE CCCCCCCCCCCCCHH | 50.65 | - | |
27 | Ubiquitination | LTTLDVTKLTPLSHE CCCCCCCCCCCCCHH | 50.65 | 21890473 | |
27 | Ubiquitination | LTTLDVTKLTPLSHE CCCCCCCCCCCCCHH | 50.65 | 21890473 | |
27 | Ubiquitination | LTTLDVTKLTPLSHE CCCCCCCCCCCCCHH | 50.65 | 21890473 | |
27 | Acetylation | LTTLDVTKLTPLSHE CCCCCCCCCCCCCHH | 50.65 | 23236377 | |
27 | Ubiquitination | LTTLDVTKLTPLSHE CCCCCCCCCCCCCHH | 50.65 | 21890473 | |
29 | Phosphorylation | TLDVTKLTPLSHEVI CCCCCCCCCCCHHHH | 24.60 | 21406692 | |
32 | Phosphorylation | VTKLTPLSHEVISRQ CCCCCCCCHHHHCCC | 20.85 | 21406692 | |
37 | Phosphorylation | PLSHEVISRQATINI CCCHHHHCCCCEEEE | 24.42 | 21406692 | |
41 | Phosphorylation | EVISRQATINIGTIG HHHCCCCEEEECCCH | 13.25 | 29083192 | |
54 | Ubiquitination | IGHVAHGKSTVVKAI CHHHHCCCCHHHHHH | 32.84 | 21963094 | |
55 | Phosphorylation | GHVAHGKSTVVKAIS HHHHCCCCHHHHHHC | 30.90 | 21854064 | |
56 | Phosphorylation | HVAHGKSTVVKAISG HHHCCCCHHHHHHCC | 32.57 | 21854064 | |
59 | Methylation | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | - | |
59 | Ubiquitination | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | 27667366 | |
59 | Malonylation | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | 26320211 | |
59 | Ubiquitination | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | 21890473 | |
59 | Ubiquitination | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | 21890473 | |
59 | Ubiquitination | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | 21890473 | |
59 | Acetylation | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | 25953088 | |
59 | Ubiquitination | HGKSTVVKAISGVHT CCCCHHHHHHCCCEE | 35.35 | 21890473 | |
66 | Phosphorylation | KAISGVHTVRFKNEL HHHCCCEEEEECCHH | 15.80 | 21854064 | |
70 | Ubiquitination | GVHTVRFKNELERNI CCEEEEECCHHHHCE | 38.66 | 21906983 | |
70 | 2-Hydroxyisobutyrylation | GVHTVRFKNELERNI CCEEEEECCHHHHCE | 38.66 | - | |
70 | Ubiquitination | GVHTVRFKNELERNI CCEEEEECCHHHHCE | 38.66 | 21890473 | |
70 | Ubiquitination | GVHTVRFKNELERNI CCEEEEECCHHHHCE | 38.66 | 21890473 | |
70 | Ubiquitination | GVHTVRFKNELERNI CCEEEEECCHHHHCE | 38.66 | 21890473 | |
70 | Acetylation | GVHTVRFKNELERNI CCEEEEECCHHHHCE | 38.66 | 26051181 | |
70 | Ubiquitination | GVHTVRFKNELERNI CCEEEEECCHHHHCE | 38.66 | 21890473 | |
80 | Ubiquitination | LERNITIKLGYANAK HHHCEEEEEECCCCE | 27.49 | 21963094 | |
80 | Acetylation | LERNITIKLGYANAK HHHCEEEEEECCCCE | 27.49 | 25953088 | |
83 | Phosphorylation | NITIKLGYANAKIYK CEEEEEECCCCEEEE | 13.71 | 29496907 | |
87 | Ubiquitination | KLGYANAKIYKLDDP EEECCCCEEEECCCC | 46.50 | 23000965 | |
87 | Acetylation | KLGYANAKIYKLDDP EEECCCCEEEECCCC | 46.50 | 26051181 | |
89 | Phosphorylation | GYANAKIYKLDDPSC ECCCCEEEECCCCCC | 12.56 | 28152594 | |
90 | Acetylation | YANAKIYKLDDPSCP CCCCEEEECCCCCCC | 49.25 | 23749302 | |
90 | Ubiquitination | YANAKIYKLDDPSCP CCCCEEEECCCCCCC | 49.25 | 23000965 | |
90 | Ubiquitination | YANAKIYKLDDPSCP CCCCEEEECCCCCCC | 49.25 | 21890473 | |
90 | Ubiquitination | YANAKIYKLDDPSCP CCCCEEEECCCCCCC | 49.25 | 21890473 | |
90 | Ubiquitination | YANAKIYKLDDPSCP CCCCEEEECCCCCCC | 49.25 | 21890473 | |
90 | Ubiquitination | YANAKIYKLDDPSCP CCCCEEEECCCCCCC | 49.25 | 21890473 | |
102 | Phosphorylation | SCPRPECYRSCGSST CCCCHHHHCCCCCCC | 12.14 | 29496907 | |
104 | Phosphorylation | PRPECYRSCGSSTPD CCHHHHCCCCCCCCC | 9.06 | 21712546 | |
105 | Glutathionylation | RPECYRSCGSSTPDE CHHHHCCCCCCCCCC | 4.54 | 22555962 | |
105 | S-nitrosylation | RPECYRSCGSSTPDE CHHHHCCCCCCCCCC | 4.54 | 22126794 | |
105 | S-palmitoylation | RPECYRSCGSSTPDE CHHHHCCCCCCCCCC | 4.54 | 26865113 | |
107 | Phosphorylation | ECYRSCGSSTPDEFP HHHCCCCCCCCCCCC | 35.05 | 23186163 | |
108 | Phosphorylation | CYRSCGSSTPDEFPT HHCCCCCCCCCCCCC | 29.28 | 21815630 | |
109 | Phosphorylation | YRSCGSSTPDEFPTD HCCCCCCCCCCCCCC | 36.13 | 21815630 | |
121 | Ubiquitination | PTDIPGTKGNFKLVR CCCCCCCCCCEEEEE | 58.74 | 27667366 | |
121 | Acetylation | PTDIPGTKGNFKLVR CCCCCCCCCCEEEEE | 58.74 | 26051181 | |
125 | Ubiquitination | PGTKGNFKLVRHVSF CCCCCCEEEEEEEEE | 50.50 | 21963094 | |
125 | Acetylation | PGTKGNFKLVRHVSF CCCCCCEEEEEEEEE | 50.50 | 25953088 | |
181 | Ubiquitination | LAAIEIMKLKHILIL HHHHHHHHHHHHHHH | 61.11 | 22817900 | |
183 | Ubiquitination | AIEIMKLKHILILQN HHHHHHHHHHHHHHC | 24.07 | 21963094 | |
183 | 2-Hydroxyisobutyrylation | AIEIMKLKHILILQN HHHHHHHHHHHHHHC | 24.07 | - | |
183 | Acetylation | AIEIMKLKHILILQN HHHHHHHHHHHHHHC | 24.07 | 26051181 | |
191 | Ubiquitination | HILILQNKIDLVKES HHHHHHCHHHHHHHH | 25.33 | 21906983 | |
191 | 2-Hydroxyisobutyrylation | HILILQNKIDLVKES HHHHHHCHHHHHHHH | 25.33 | - | |
196 | Ubiquitination | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | 27667366 | |
196 | 2-Hydroxyisobutyrylation | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | - | |
196 | Malonylation | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | 26320211 | |
196 | Ubiquitination | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | 21890473 | |
196 | Ubiquitination | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | 21890473 | |
196 | Ubiquitination | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | 21890473 | |
196 | Acetylation | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | 26051181 | |
196 | Ubiquitination | QNKIDLVKESQAKEQ HCHHHHHHHHHHHHH | 59.97 | 21890473 | |
201 | Ubiquitination | LVKESQAKEQYEQIL HHHHHHHHHHHHHHH | 37.40 | 22817900 | |
236 | S-nitrosocysteine | KYNIEVVCEYIVKKI CCCHHHHHHHHHHCC | 3.87 | - | |
236 | S-nitrosylation | KYNIEVVCEYIVKKI CCCHHHHHHHHHHCC | 3.87 | 22178444 | |
238 | Phosphorylation | NIEVVCEYIVKKIPV CHHHHHHHHHHCCCC | 13.09 | 28152594 | |
241 | Ubiquitination | VVCEYIVKKIPVPPR HHHHHHHHCCCCCCC | 35.11 | 21963094 | |
241 | Acetylation | VVCEYIVKKIPVPPR HHHHHHHHCCCCCCC | 35.11 | 26051181 | |
242 | Ubiquitination | VCEYIVKKIPVPPRD HHHHHHHCCCCCCCC | 41.15 | 22817900 | |
266 | Ubiquitination | IRSFDVNKPGCEVDD EEEECCCCCCCEECC | 42.51 | 21963094 | |
266 | 2-Hydroxyisobutyrylation | IRSFDVNKPGCEVDD EEEECCCCCCCEECC | 42.51 | - | |
266 | Acetylation | IRSFDVNKPGCEVDD EEEECCCCCCCEECC | 42.51 | 26822725 | |
275 | Ubiquitination | GCEVDDLKGGVAGGS CCEECCCCCCCCCHH | 61.69 | 23000965 | |
275 | Ubiquitination | GCEVDDLKGGVAGGS CCEECCCCCCCCCHH | 61.69 | - | |
275 | 2-Hydroxyisobutyrylation | GCEVDDLKGGVAGGS CCEECCCCCCCCCHH | 61.69 | - | |
275 | Acetylation | GCEVDDLKGGVAGGS CCEECCCCCCCCCHH | 61.69 | 25953088 | |
282 | Phosphorylation | KGGVAGGSILKGVLK CCCCCCHHHHHHHHH | 24.67 | 24719451 | |
285 | Ubiquitination | VAGGSILKGVLKVGQ CCCHHHHHHHHHCCC | 45.35 | 23000965 | |
285 | Ubiquitination | VAGGSILKGVLKVGQ CCCHHHHHHHHHCCC | 45.35 | - | |
285 | 2-Hydroxyisobutyrylation | VAGGSILKGVLKVGQ CCCHHHHHHHHHCCC | 45.35 | - | |
285 | Succinylation | VAGGSILKGVLKVGQ CCCHHHHHHHHHCCC | 45.35 | 23954790 | |
289 | Ubiquitination | SILKGVLKVGQEIEV HHHHHHHHCCCEEEE | 41.74 | 23000965 | |
289 | Ubiquitination | SILKGVLKVGQEIEV HHHHHHHHCCCEEEE | 41.74 | 21890473 | |
289 | Ubiquitination | SILKGVLKVGQEIEV HHHHHHHHCCCEEEE | 41.74 | 21890473 | |
289 | Ubiquitination | SILKGVLKVGQEIEV HHHHHHHHCCCEEEE | 41.74 | 21890473 | |
289 | Ubiquitination | SILKGVLKVGQEIEV HHHHHHHHCCCEEEE | 41.74 | 21890473 | |
302 | Phosphorylation | EVRPGIVSKDSEGKL EECCCCCCCCCCCCE | 28.91 | 23911959 | |
303 | Acetylation | VRPGIVSKDSEGKLM ECCCCCCCCCCCCEE | 55.14 | 26051181 | |
303 | Ubiquitination | VRPGIVSKDSEGKLM ECCCCCCCCCCCCEE | 55.14 | 27667366 | |
303 | 2-Hydroxyisobutyrylation | VRPGIVSKDSEGKLM ECCCCCCCCCCCCEE | 55.14 | - | |
303 | Malonylation | VRPGIVSKDSEGKLM ECCCCCCCCCCCCEE | 55.14 | 26320211 | |
305 | Phosphorylation | PGIVSKDSEGKLMCK CCCCCCCCCCCEECH | 52.57 | 29507054 | |
308 | Ubiquitination | VSKDSEGKLMCKPIF CCCCCCCCEECHHHH | 29.06 | 21963094 | |
308 | Acetylation | VSKDSEGKLMCKPIF CCCCCCCCEECHHHH | 29.06 | 25953088 | |
312 | Acetylation | SEGKLMCKPIFSKIV CCCCEECHHHHHHHH | 27.47 | 25825284 | |
312 | Ubiquitination | SEGKLMCKPIFSKIV CCCCEECHHHHHHHH | 27.47 | 21963094 | |
316 | Phosphorylation | LMCKPIFSKIVSLFA EECHHHHHHHHHHHH | 23.38 | 24719451 | |
317 | Ubiquitination | MCKPIFSKIVSLFAE ECHHHHHHHHHHHHH | 36.06 | 21963094 | |
320 | O-linked_Glycosylation | PIFSKIVSLFAEHND HHHHHHHHHHHHCCC | 22.65 | 23301498 | |
330 | Phosphorylation | AEHNDLQYAAPGGLI HHCCCCCCCCCCCEE | 16.42 | 27642862 | |
342 | Ubiquitination | GLIGVGTKIDPTLCR CEEEECCCCCHHHHH | 38.90 | 21963094 | |
346 | Phosphorylation | VGTKIDPTLCRADRM ECCCCCHHHHHHHHH | 34.44 | 24043423 | |
369 | Phosphorylation | GALPEIFTELEISYF CCCHHHHHHHHHHHH | 45.37 | 24043423 | |
374 | Phosphorylation | IFTELEISYFLLRRL HHHHHHHHHHHHHHH | 10.64 | 24043423 | |
375 | Phosphorylation | FTELEISYFLLRRLL HHHHHHHHHHHHHHH | 12.14 | 24043423 | |
397 | Ubiquitination | KKAAKVQKLSKNEVL HHHHHHHHCCCCCEE | 58.68 | 22817900 | |
399 | Phosphorylation | AAKVQKLSKNEVLMV HHHHHHCCCCCEEEE | 40.23 | 21406692 | |
400 | Ubiquitination | AKVQKLSKNEVLMVN HHHHHCCCCCEEEEE | 68.51 | 21963094 | |
405 | Sulfoxidation | LSKNEVLMVNIGSLS CCCCCEEEEEECCCC | 2.34 | 28183972 | |
410 | Phosphorylation | VLMVNIGSLSTGGRV EEEEEECCCCCCCCC | 18.49 | 21406692 | |
412 | Phosphorylation | MVNIGSLSTGGRVSA EEEECCCCCCCCCEE | 27.06 | 21406692 | |
413 | Phosphorylation | VNIGSLSTGGRVSAV EEECCCCCCCCCEEE | 49.28 | 21406692 | |
418 | Phosphorylation | LSTGGRVSAVKADLG CCCCCCCEEEECCCC | 26.45 | 21854064 | |
421 | Ubiquitination | GGRVSAVKADLGKIV CCCCEEEECCCCCEE | 35.58 | 27667366 | |
421 | Malonylation | GGRVSAVKADLGKIV CCCCEEEECCCCCEE | 35.58 | 26320211 | |
421 | Ubiquitination | GGRVSAVKADLGKIV CCCCEEEECCCCCEE | 35.58 | 21890473 | |
421 | Ubiquitination | GGRVSAVKADLGKIV CCCCEEEECCCCCEE | 35.58 | 21890473 | |
421 | Ubiquitination | GGRVSAVKADLGKIV CCCCEEEECCCCCEE | 35.58 | 21890473 | |
421 | Ubiquitination | GGRVSAVKADLGKIV CCCCEEEECCCCCEE | 35.58 | 21890473 | |
426 | Ubiquitination | AVKADLGKIVLTNPV EEECCCCCEEECCCC | 36.62 | 21963094 | |
426 | 2-Hydroxyisobutyrylation | AVKADLGKIVLTNPV EEECCCCCEEECCCC | 36.62 | - | |
426 | Malonylation | AVKADLGKIVLTNPV EEECCCCCEEECCCC | 36.62 | 26320211 | |
426 | Acetylation | AVKADLGKIVLTNPV EEECCCCCEEECCCC | 36.62 | 26051181 | |
435 | Phosphorylation | VLTNPVCTEVGEKIA EECCCCCCHHHHHHH | 33.66 | 21854064 | |
440 | Ubiquitination | VCTEVGEKIALSRRV CCCHHHHHHHHHHHH | 27.61 | 21963094 | |
440 | 2-Hydroxyisobutyrylation | VCTEVGEKIALSRRV CCCHHHHHHHHHHHH | 27.61 | - | |
440 | Acetylation | VCTEVGEKIALSRRV CCCHHHHHHHHHHHH | 27.61 | 25953088 | |
444 | Phosphorylation | VGEKIALSRRVEKHW HHHHHHHHHHHHHHH | 14.71 | 24719451 | |
449 | Ubiquitination | ALSRRVEKHWRLIGW HHHHHHHHHHEECCC | 45.68 | 21963094 | |
449 | Acetylation | ALSRRVEKHWRLIGW HHHHHHHHHHEECCC | 45.68 | 25953088 | |
466 | Ubiquitination | IRRGVTIKPTVDDD- CCCCEEECCCCCCC- | 25.85 | 21906983 | |
466 | Acetylation | IRRGVTIKPTVDDD- CCCCEEECCCCCCC- | 25.85 | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
66 | T | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF2G_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF2G_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AIMP1_HUMAN | AIMP1 | physical | 22863883 | |
IMDH2_HUMAN | IMPDH2 | physical | 22863883 | |
IQGA1_HUMAN | IQGAP1 | physical | 22863883 | |
CCAR2_HUMAN | CCAR2 | physical | 22863883 | |
PLD3_HUMAN | PLD3 | physical | 22863883 | |
RS4X_HUMAN | RPS4X | physical | 26344197 | |
PYM1_HUMAN | WIBG | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...