UniProt ID | DGR1_YEAST | |
---|---|---|
UniProt AC | Q3E808 | |
Protein Name | 2-deoxy-glucose resistant protein 1, mitochondrial | |
Gene Name | DGR1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 48 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MQVGFVSQTNCRSFPACIVFLFQMSQRQRSFNANLRVFKSKCKKIYIG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DGR1_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DGR1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DGR1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DGR1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MOB2_YEAST | MOB2 | genetic | 27708008 | |
CDK1_YEAST | CDC28 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
TIM22_YEAST | TIM22 | genetic | 27708008 | |
YRB1_YEAST | YRB1 | genetic | 27708008 | |
PSF1_YEAST | PSF1 | genetic | 27708008 | |
RPC10_YEAST | RPC11 | genetic | 27708008 | |
PDC2_YEAST | PDC2 | genetic | 27708008 | |
CDC4_YEAST | CDC4 | genetic | 27708008 | |
SAD1_YEAST | SAD1 | genetic | 27708008 | |
SLD3_YEAST | SLD3 | genetic | 27708008 | |
CDC20_YEAST | CDC20 | genetic | 27708008 | |
BRL1_YEAST | BRL1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
DNA2_YEAST | DNA2 | genetic | 27708008 | |
STS1_YEAST | STS1 | genetic | 27708008 | |
DPB11_YEAST | DPB11 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
SMC4_YEAST | SMC4 | genetic | 27708008 | |
LCB1_YEAST | LCB1 | genetic | 27708008 | |
DED1_YEAST | DED1 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...