| UniProt ID | DGR1_YEAST | |
|---|---|---|
| UniProt AC | Q3E808 | |
| Protein Name | 2-deoxy-glucose resistant protein 1, mitochondrial | |
| Gene Name | DGR1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 48 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MQVGFVSQTNCRSFPACIVFLFQMSQRQRSFNANLRVFKSKCKKIYIG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of DGR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DGR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DGR1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DGR1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| CDK1_YEAST | CDC28 | genetic | 27708008 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| TIM22_YEAST | TIM22 | genetic | 27708008 | |
| YRB1_YEAST | YRB1 | genetic | 27708008 | |
| PSF1_YEAST | PSF1 | genetic | 27708008 | |
| RPC10_YEAST | RPC11 | genetic | 27708008 | |
| PDC2_YEAST | PDC2 | genetic | 27708008 | |
| CDC4_YEAST | CDC4 | genetic | 27708008 | |
| SAD1_YEAST | SAD1 | genetic | 27708008 | |
| SLD3_YEAST | SLD3 | genetic | 27708008 | |
| CDC20_YEAST | CDC20 | genetic | 27708008 | |
| BRL1_YEAST | BRL1 | genetic | 27708008 | |
| MED6_YEAST | MED6 | genetic | 27708008 | |
| DNA2_YEAST | DNA2 | genetic | 27708008 | |
| STS1_YEAST | STS1 | genetic | 27708008 | |
| DPB11_YEAST | DPB11 | genetic | 27708008 | |
| CDC11_YEAST | CDC11 | genetic | 27708008 | |
| SMC4_YEAST | SMC4 | genetic | 27708008 | |
| LCB1_YEAST | LCB1 | genetic | 27708008 | |
| DED1_YEAST | DED1 | genetic | 27708008 | |
| BUR1_YEAST | SGV1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...