CL049_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CL049_HUMAN
• UniProt AC: Q9H741
• Protein Name: UPF0454 protein C12orf49
• Gene Name: C12orf49
• Organism: Homo sapiens (Human).
• Sequence Length: 205
• Subcellular Localization: Secreted .
• Protein Sequence: MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CL049_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CL049_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CL049_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CL049_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PLS1_HUMAN	PLSCR1	physical	28514442
ASPH2_HUMAN	ASPHD2	physical	28514442
HTRA1_HUMAN	HTRA1	physical	28514442
KNTC1_HUMAN	KNTC1	physical	28514442
ZWILC_HUMAN	ZWILCH	physical	28514442
LNP_HUMAN	KIAA1715	physical	28514442
SCPDL_HUMAN	SCCPDH	physical	28514442
PPAL_HUMAN	ACP2	physical	28514442
ARV1_HUMAN	ARV1	physical	28514442
CALX_HUMAN	CANX	physical	28514442
ZNT7_HUMAN	SLC30A7	physical	28514442
AT2B2_HUMAN	ATP2B2	physical	28514442
METL9_HUMAN	METTL9	physical	28514442
PEX19_HUMAN	PEX19	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.