UniProt ID | CDN2D_HUMAN | |
---|---|---|
UniProt AC | P55273 | |
Protein Name | Cyclin-dependent kinase 4 inhibitor D | |
Gene Name | CDKN2D | |
Organism | Homo sapiens (Human). | |
Sequence Length | 166 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | Interacts strongly with CDK4 and CDK6 and inhibits them.. | |
Protein Sequence | MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MLLEEVRA -------CCCCCHHC | 9.70 | 12665801 | |
66 | Phosphorylation | ELLKQGASPNVQDTS HHHHCCCCCCCCCCC | 24.67 | 22817900 | |
73 | Phosphorylation | SPNVQDTSGTSPVHD CCCCCCCCCCCCHHH | 48.65 | 30576142 | |
75 | Phosphorylation | NVQDTSGTSPVHDAA CCCCCCCCCCHHHHH | 29.62 | 30576142 | |
76 | Phosphorylation | VQDTSGTSPVHDAAR CCCCCCCCCHHHHHH | 28.57 | 22817900 | |
84 | Phosphorylation | PVHDAARTGFLDTLK CHHHHHHCCHHHHHH | 27.79 | 30576142 | |
89 | Phosphorylation | ARTGFLDTLKVLVEH HHCCHHHHHHHHHHC | 30.53 | - | |
141 | Phosphorylation | RRDARGLTPLELALQ HCCCCCCCHHHHHHH | 28.75 | 22558186 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
66 | S | Phosphorylation | Kinase | MAPK14 | Q16539 | GPS |
76 | S | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
76 | S | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
141 | T | Phosphorylation | Kinase | PRKACA | P00517 | GPS |
141 | T | Phosphorylation | Kinase | PKACA | P17612 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDN2D_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDN2D_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBC17_HUMAN | TBC1D17 | physical | 16189514 | |
BRCA1_HUMAN | BRCA1 | physical | 17334399 | |
A4_HUMAN | APP | physical | 21832049 | |
CDK4_HUMAN | CDK4 | physical | 23718855 | |
NR4A1_HUMAN | NR4A1 | physical | 25416956 | |
NR4A2_HUMAN | NR4A2 | physical | 25416956 | |
IKZF3_HUMAN | IKZF3 | physical | 25416956 | |
DHB14_HUMAN | HSD17B14 | physical | 25416956 | |
CA094_HUMAN | C1orf94 | physical | 25416956 | |
INCA1_HUMAN | INCA1 | physical | 25416956 | |
IKZF3_HUMAN | IKZF3 | physical | 21516116 | |
CA094_HUMAN | C1orf94 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides."; Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.; Nat. Biotechnol. 21:566-569(2003). Cited for: PROTEIN SEQUENCE OF 1-7, AND ACETYLATION AT MET-1. |