UniProt ID | ARL4C_HUMAN | |
---|---|---|
UniProt AC | P56559 | |
Protein Name | ADP-ribosylation factor-like protein 4C | |
Gene Name | ARL4C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 192 | |
Subcellular Localization | Cell projection, filopodium. Cell membrane. Cytoplasm. | |
Protein Description | Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. May be involved in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in the GDP-bound form. Regulates the microtubule-dependent intracellular vesicular transport from early endosome to recycling endosome process.. | |
Protein Sequence | MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNISSNIS ------CCCCHHHHH | 39.93 | - | |
9 | Phosphorylation | GNISSNISAFQSLHI CCCHHHHHHHHHHEE | 27.55 | 24719451 | |
31 | Phosphorylation | AGKTTVLYRLKFNEF CCCEEEEEEEEHHHH | 15.01 | 24719451 | |
51 | Ubiquitination | TIGFNTEKIKLSNGT CCCCCCCEEEECCCC | 43.00 | - | |
53 | Ubiquitination | GFNTEKIKLSNGTAK CCCCCEEEECCCCCC | 57.86 | - | |
60 | Ubiquitination | KLSNGTAKGISCHFW EECCCCCCEEEEEEE | 57.52 | - | |
74 | Ubiquitination | WDVGGQEKLRPLWKS EECCCCCCCHHHHHH | 41.74 | - | |
80 | Ubiquitination | EKLRPLWKSYSRCTD CCCHHHHHHHHCCCC | 47.39 | - | |
80 | Ubiquitination | EKLRPLWKSYSRCTD CCCHHHHHHHHCCCC | 47.39 | - | |
106 | Phosphorylation | DRLEEAKTELHKVTK HHHHHHHHHHHHHHH | 51.32 | 23403867 | |
110 | Ubiquitination | EAKTELHKVTKFAEN HHHHHHHHHHHHHHH | 65.31 | - | |
113 | Ubiquitination | TELHKVTKFAENQGT HHHHHHHHHHHHCCC | 45.63 | 21906983 | |
113 | Ubiquitination | TELHKVTKFAENQGT HHHHHHHHHHHHCCC | 45.63 | - | |
128 | Ubiquitination | PLLVIANKQDLPKSL CEEEEEECCCCCCCC | 35.85 | - | |
133 | Ubiquitination | ANKQDLPKSLPVAEI EECCCCCCCCCHHHH | 72.43 | - | |
133 | Ubiquitination | ANKQDLPKSLPVAEI EECCCCCCCCCHHHH | 72.43 | - | |
181 | Ubiquitination | KLYEMILKRRKSLKQ HHHHHHHHHHHHHHH | 38.95 | 2189047 | |
181 | Ubiquitination | KLYEMILKRRKSLKQ HHHHHHHHHHHHHHH | 38.95 | - | |
185 | Phosphorylation | MILKRRKSLKQKKKR HHHHHHHHHHHHHCC | 38.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL4C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL4C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL4C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
XRCC2_HUMAN | XRCC2 | physical | 28514442 | |
RGS12_HUMAN | RGS12 | physical | 28514442 | |
FBX33_HUMAN | FBXO33 | physical | 28514442 | |
DIRA1_HUMAN | DIRAS1 | physical | 28514442 | |
TERF2_HUMAN | TERF2 | physical | 28514442 | |
RA51B_HUMAN | RAD51B | physical | 28514442 | |
KBRS1_HUMAN | NKIRAS1 | physical | 28514442 | |
DJC12_HUMAN | DNAJC12 | physical | 28514442 | |
DPOE2_HUMAN | POLE2 | physical | 28514442 | |
TE2IP_HUMAN | TERF2IP | physical | 28514442 | |
RA51D_HUMAN | RAD51D | physical | 28514442 | |
ARL10_HUMAN | ARL10 | physical | 28514442 | |
DPOE4_HUMAN | POLE4 | physical | 28514442 | |
PAF1_HUMAN | PAF1 | physical | 28514442 | |
GAB1_HUMAN | GAB1 | physical | 28514442 | |
OAF_HUMAN | OAF | physical | 28514442 | |
ARF5_HUMAN | ARF5 | physical | 28514442 | |
GDS1_HUMAN | RAP1GDS1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...