RA51B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RA51B_HUMAN
• UniProt AC: O15315
• Protein Name: DNA repair protein RAD51 homolog 2
• Gene Name: RAD51B
• Organism: Homo sapiens (Human).
• Sequence Length: 384
• Subcellular Localization: Nucleus .
• Protein Description: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway..
• Protein Sequence: MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	Phosphorylation	ACAPKMQTAYGIKAQ HHCCCCHHHHCHHCC	20.53	-
66	O-linked_Glycosylation	ACAPKMQTAYGIKAQ HHCCCCHHHHCHHCC	20.53	30379171
201	Phosphorylation	SLEEEIISKGIKLVI HHHHHHHHCCCEEEE	30.41	27732954
211	Phosphorylation	IKLVILDSVASVVRK CEEEEEHHHHHHHHH	19.01	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RA51B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RA51B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RA51B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RA51C_HUMAN	RAD51C	physical	11751636
RA51C_HUMAN	RAD51C	physical	11744692
RA51D_HUMAN	RAD51D	physical	11744692
XRCC2_HUMAN	XRCC2	physical	11744692
SWAP1_HUMAN	SWSAP1	physical	21965664
FAM9B_HUMAN	FAM9B	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.