SWAP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SWAP1_HUMAN
• UniProt AC: Q6NVH7
• Protein Name: ATPase SWSAP1
• Gene Name: SWSAP1
• Organism: Homo sapiens (Human).
• Sequence Length: 229
• Subcellular Localization: Nucleus .
• Protein Description: ATPase which is preferentially stimulated by single-stranded DNA and is involved in homologous recombination repair (HRR). Has a DNA-binding activity which is independent of its ATPase activity..
• Protein Sequence: MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	GTPGSGKTALLFAAA ECCCCHHHHHHHHHH	26.51	22210691
47	Phosphorylation	LTRRPLQSMPRGTGT EECCCCCCCCCCCCC	38.14	29083192
52	Phosphorylation	LQSMPRGTGTTLDPM CCCCCCCCCCCCCHH	32.41	29083192
54	Phosphorylation	SMPRGTGTTLDPMRL CCCCCCCCCCCHHHH	24.83	29083192
55	Phosphorylation	MPRGTGTTLDPMRLQ CCCCCCCCCCHHHHH	30.43	29083192
101	Phosphorylation	LLDGLEEYLAEDPEP EHHCHHHHHHHCCCH	11.22	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SWAP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SWAP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SWAP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZSWM7_HUMAN	ZSWIM7	physical	21965664
RAD51_HUMAN	RAD51	physical	21965664
RA51B_HUMAN	RAD51B	physical	21965664
RA51C_HUMAN	RAD51C	physical	21965664
RA51D_HUMAN	RAD51D	physical	21965664
XRCC3_HUMAN	XRCC3	physical	21965664
ZSWM7_HUMAN	ZSWIM7	physical	28514442
G3PT_HUMAN	GAPDHS	physical	28514442
UBB_HUMAN	UBB	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.