AMOS_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AMOS_DROME
• UniProt AC: Q9Y0A7
• Protein Name: Basic helix-loop-helix transcription factor amos
• Gene Name: amos
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 198
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor involved in early neurogenesis; sensillum basiconica formation and maybe sensillum trichodea development. Promotes multiple dendritic (MD) neuron formation. Required for olfactory sensilla; regulated by lozenge (lz)..
• Protein Sequence: MLTNNELMEQFYFPDEAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRDY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of AMOS_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AMOS_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AMOS_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AMOS_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AST4_DROME	sc	genetic	12925594
NOTCH_DROME	N	genetic	12702684
LOZEN_DROME	lz	genetic	12925594
DA_DROME	da	genetic	10707972
DA_DROME	da	genetic	11861566
DA_DROME	da	genetic	12702685
EMC_DROME	emc	genetic	12702684
DL_DROME	Dl	genetic	12702684
HLES_DROME	H	genetic	12702684
HH_DROME	hh	genetic	11861566
ESM8_DROME	E(spl)m8-HLH	genetic	12702684

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.