UniProt ID | AMOS_DROME | |
---|---|---|
UniProt AC | Q9Y0A7 | |
Protein Name | Basic helix-loop-helix transcription factor amos | |
Gene Name | amos | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 198 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor involved in early neurogenesis; sensillum basiconica formation and maybe sensillum trichodea development. Promotes multiple dendritic (MD) neuron formation. Required for olfactory sensilla; regulated by lozenge (lz).. | |
Protein Sequence | MLTNNELMEQFYFPDEAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRDY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of AMOS_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AMOS_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AMOS_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AMOS_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AST4_DROME | sc | genetic | 12925594 | |
NOTCH_DROME | N | genetic | 12702684 | |
LOZEN_DROME | lz | genetic | 12925594 | |
DA_DROME | da | genetic | 10707972 | |
DA_DROME | da | genetic | 11861566 | |
DA_DROME | da | genetic | 12702685 | |
EMC_DROME | emc | genetic | 12702684 | |
DL_DROME | Dl | genetic | 12702684 | |
HLES_DROME | H | genetic | 12702684 | |
HH_DROME | hh | genetic | 11861566 | |
ESM8_DROME | E(spl)m8-HLH | genetic | 12702684 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...