AHP2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AHP2_ARATH
• UniProt AC: Q9ZNV8
• Protein Name: Histidine-containing phosphotransfer protein 2
• Gene Name: AHP2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 156
• Subcellular Localization: Cytoplasm, cytosol . Nucleus .
• Protein Description: Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay..
• Protein Sequence: MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDALIAQL -------CHHHHHHH	6.49	22223895
82	Phosphorylation	SQVGASVHQLKGSSS HHCCCCHHHCCCCCC	25.43	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AHP2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AHP2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AHP2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARR9_ARATH	ARR9	physical	10930573
ARR1_ARATH	RR1	physical	11158442
ARR2_ARATH	RR2	physical	11158442
ARR10_ARATH	RR10	physical	11158442
TCP10_ARATH	TCP10	physical	11158442
ARR2_ARATH	RR2	physical	11370868
MND1_ARATH	ATMND1	physical	16763194
GONS1_ARATH	GONST1	physical	22737156
YSL3_ARATH	YSL3	physical	22737156
AB10G_ARATH	AT1G53270	physical	22737156
CNG18_ARATH	CNGC18	physical	22737156
ETR1_ARATH	ETR1	physical	16965536
AHK1_ARATH	HK1	physical	16965536
AHK4_ARATH	WOL	physical	16965536
ARR1_ARATH	RR1	physical	16965536
ARR2_ARATH	RR2	physical	16965536
ARR3_ARATH	ARR3	physical	16965536
ARR4_ARATH	ARR4	physical	16965536
ARR8_ARATH	RR3	physical	16965536
ARR9_ARATH	ARR9	physical	16965536
ARR10_ARATH	RR10	physical	16965536
ARR11_ARATH	ARR11	physical	16965536
AHK2_ARATH	HK2	physical	16965536
AHK3_ARATH	HK3	physical	16965536
ARR14_ARATH	RR14	physical	16965536
ARR5_ARATH	RR5	physical	16965536
ARR7_ARATH	ARR7	physical	16965536
MIP1_ARATH	AT1G32530	physical	19187040

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.