| UniProt ID | AHP2_ARATH | |
|---|---|---|
| UniProt AC | Q9ZNV8 | |
| Protein Name | Histidine-containing phosphotransfer protein 2 | |
| Gene Name | AHP2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 156 | |
| Subcellular Localization | Cytoplasm, cytosol . Nucleus . | |
| Protein Description | Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay.. | |
| Protein Sequence | MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AHP2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AHP2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AHP2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARR9_ARATH | ARR9 | physical | 10930573 | |
| ARR1_ARATH | RR1 | physical | 11158442 | |
| ARR2_ARATH | RR2 | physical | 11158442 | |
| ARR10_ARATH | RR10 | physical | 11158442 | |
| TCP10_ARATH | TCP10 | physical | 11158442 | |
| ARR2_ARATH | RR2 | physical | 11370868 | |
| MND1_ARATH | ATMND1 | physical | 16763194 | |
| GONS1_ARATH | GONST1 | physical | 22737156 | |
| YSL3_ARATH | YSL3 | physical | 22737156 | |
| AB10G_ARATH | AT1G53270 | physical | 22737156 | |
| CNG18_ARATH | CNGC18 | physical | 22737156 | |
| ETR1_ARATH | ETR1 | physical | 16965536 | |
| AHK1_ARATH | HK1 | physical | 16965536 | |
| AHK4_ARATH | WOL | physical | 16965536 | |
| ARR1_ARATH | RR1 | physical | 16965536 | |
| ARR2_ARATH | RR2 | physical | 16965536 | |
| ARR3_ARATH | ARR3 | physical | 16965536 | |
| ARR4_ARATH | ARR4 | physical | 16965536 | |
| ARR8_ARATH | RR3 | physical | 16965536 | |
| ARR9_ARATH | ARR9 | physical | 16965536 | |
| ARR10_ARATH | RR10 | physical | 16965536 | |
| ARR11_ARATH | ARR11 | physical | 16965536 | |
| AHK2_ARATH | HK2 | physical | 16965536 | |
| AHK3_ARATH | HK3 | physical | 16965536 | |
| ARR14_ARATH | RR14 | physical | 16965536 | |
| ARR5_ARATH | RR5 | physical | 16965536 | |
| ARR7_ARATH | ARR7 | physical | 16965536 | |
| MIP1_ARATH | AT1G32530 | physical | 19187040 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...