GONS1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GONS1_ARATH
• UniProt AC: Q941R4
• Protein Name: GDP-mannose transporter GONST1 {ECO:0000303|PubMed:11595802}
• Gene Name: GONST1 {ECO:0000312|EMBL:CAC69066.1}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 333
• Subcellular Localization: Golgi apparatus membrane ; Multi-pass membrane protein .
• Protein Description: Involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen. [PubMed: 11595802]
• Protein Sequence: MKLYEHDGVDLEDGKTVKSGGDKPIPRKIHNRALLSGLAYCISSCSMILVNKFVLSSYNFNAGIFLMLYQNFVSVIIVVGLSLMGLITTEPLTLRLMKVWFPVNVIFVGMLITSMFSLKYINVAMVTVLKNVTNVITAVGEMYLFNKQHDNRVWAALFLMIISAVSGGITDLSFNAVGYAWQIANCFLTASYSLTLRKTMDTAKQVTQSGNLNEFSMVLLNNTLSLPLGLLLSYFFNEMDYLYQTPLLRLPSFWMVMTLSGLLGLAISFTSMWFLHQTGATTYSLVGSLNKIPLSIAGIVLFNVPTSLQNSASILFGLVAGVVFARAKMREKS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GONS1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GONS1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GONS1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GONS1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GCL1_ARATH	GCL1	physical	22737156
GONS1_ARATH	GONST1	physical	22737156
YKT61_ARATH	YKT61	physical	22737156

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.