YKT61_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YKT61_ARATH
• UniProt AC: Q9ZRD6
• Protein Name: VAMP-like protein YKT61
• Gene Name: YKT61
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 199
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: May be involved in the secretory pathway..
• Protein Sequence: MKITALLVLKCAPEASDPVILSNASDVSHFGYFQRSSVKEFVVFVGRTVASRTPPSQRQSVQHEEYKVHAYNRNGLCAVGFMDDHYPVRSAFSLLNQVLDEYQKSFGESWRSAKEDSNQPWPYLTEALNKFQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSMASQMFYKQAKKTNSCCTIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
170	Phosphorylation	ARGEKLDSLVEKSSD HCCHHHHHHHHHHCC	44.76	30291188
175	Phosphorylation	LDSLVEKSSDLSMAS HHHHHHHHCCCHHHH	18.64	19880383
176	Phosphorylation	DSLVEKSSDLSMASQ HHHHHHHCCCHHHHH	54.35	30589143
179	Phosphorylation	VEKSSDLSMASQMFY HHHHCCCHHHHHHHH	19.79	25561503
195	S-palmitoylation	QAKKTNSCCTIL--- HHHHHCCCCCCC---	2.29	-
196	Geranylgeranylation	AKKTNSCCTIL---- HHHHCCCCCCC----	2.38	-
196	Methylation	AKKTNSCCTIL---- HHHHCCCCCCC----	2.38	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YKT61_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YKT61_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YKT61_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of YKT61_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.