UniProt ID | YKT61_ARATH | |
---|---|---|
UniProt AC | Q9ZRD6 | |
Protein Name | VAMP-like protein YKT61 | |
Gene Name | YKT61 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 199 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | May be involved in the secretory pathway.. | |
Protein Sequence | MKITALLVLKCAPEASDPVILSNASDVSHFGYFQRSSVKEFVVFVGRTVASRTPPSQRQSVQHEEYKVHAYNRNGLCAVGFMDDHYPVRSAFSLLNQVLDEYQKSFGESWRSAKEDSNQPWPYLTEALNKFQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSMASQMFYKQAKKTNSCCTIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
170 | Phosphorylation | ARGEKLDSLVEKSSD HCCHHHHHHHHHHCC | 44.76 | 30291188 | |
175 | Phosphorylation | LDSLVEKSSDLSMAS HHHHHHHHCCCHHHH | 18.64 | 19880383 | |
176 | Phosphorylation | DSLVEKSSDLSMASQ HHHHHHHCCCHHHHH | 54.35 | 30589143 | |
179 | Phosphorylation | VEKSSDLSMASQMFY HHHHCCCHHHHHHHH | 19.79 | 25561503 | |
195 | S-palmitoylation | QAKKTNSCCTIL--- HHHHHCCCCCCC--- | 2.29 | - | |
196 | Geranylgeranylation | AKKTNSCCTIL---- HHHHCCCCCCC---- | 2.38 | - | |
196 | Methylation | AKKTNSCCTIL---- HHHHCCCCCCC---- | 2.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKT61_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKT61_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKT61_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YKT61_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...