MND1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MND1_ARATH
• UniProt AC: Q8GYD2
• Protein Name: Meiotic nuclear division protein 1 homolog
• Gene Name: MND1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 230
• Subcellular Localization: Nucleus . Nucleus, nucleolus . Localized to chromatin during meiosis.
• Protein Description: Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates both DMC1/LIM15- and RAD51-mediated homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks..
• Protein Sequence: MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVAKDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERTEALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCSNNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSSSHEADTAKQLVQDEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MSKKRGLSLEEKREK CCCCCCCCHHHHHHH	36.24	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MND1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MND1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MND1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AHP2_ARATH	AHP2	physical	16763194

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.