dbPTM

ARR7_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ARR7_ARATH
UniProt AC	Q9ZWS7
Protein Name	Two-component response regulator ARR7
Gene Name	ARR7
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	206
Subcellular Localization	Nucleus .
Protein Description	Functions as response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling..
Protein Sequence	MAVGEVMRMEIPAGGDLTVTTPELHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGGKGASNLKDLKVNLIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQECLKEGAEEFLLKPVKLADVKRIKQLIMRNEAEECKILSHSNKRKLQEDSDTSSSSHDDTSIKDSSCSKRMKSESENLFSLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
85	Phosphorylation	KVNLIVTDYSMPGLS EEEEEEECCCCCCCC	23.71	-
197	Phosphorylation	SCSKRMKSESENLFS HHHHHHCHHHHCHHH	36.69	24894044
199	Phosphorylation	SKRMKSESENLFSLL HHHHCHHHHCHHHCC	38.59	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ARR7_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ARR7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ARR7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AHP3_ARATH	AHP3	physical	18642946
AHP2_ARATH	AHP2	physical	18642946
AHP1_ARATH	AHP1	physical	18642946
MD37F_ARATH	BIP2	physical	18642946
NUDT3_ARATH	NUDT3	physical	18642946
AZF3_ARATH	ZF3	physical	18642946
CCC12_ARATH	AT5G48630	physical	18642946
NAP1B_ARATH	NAP1;2	physical	18642946
LSH3_ARATH	LSH3	physical	18642946

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ARR7_ARATH

Related Literatures of Post-Translational Modification