dbPTM

AHP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AHP1_ARATH
UniProt AC	Q9ZNV9
Protein Name	Histidine-containing phosphotransfer protein 1
Gene Name	AHP1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	154
Subcellular Localization	Cytoplasm, cytosol . Nucleus .
Protein Description	Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay..
Protein Sequence	MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVELGF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
1	Acetylation	-------MDLVQKQK -------CCHHHHHH	8.96	-
79	Phosphorylation	KKVDPHVHQLKGSSS HHCCCCHHHCCCCCC	24.99	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AHP1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AHP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AHP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARR4_ARATH	ARR4	physical	17545225
ARR4_ARATH	ARR4	physical	10930573
ARR9_ARATH	ARR9	physical	10930573
ARR1_ARATH	RR1	physical	11158442
TCP10_ARATH	TCP10	physical	11158442
ARR2_ARATH	RR2	physical	11370868
IF5A2_ARATH	FBR12	physical	24163315
AHK4_ARATH	WOL	physical	24163315
ARR4_ARATH	ARR4	physical	25643735
ETR1_ARATH	ETR1	physical	16965536
ARR1_ARATH	RR1	physical	16965536
ARR2_ARATH	RR2	physical	16965536
ARR3_ARATH	ARR3	physical	16965536
ARR4_ARATH	ARR4	physical	16965536
ARR8_ARATH	RR3	physical	16965536
ARR9_ARATH	ARR9	physical	16965536
ARR10_ARATH	RR10	physical	16965536
AHK2_ARATH	HK2	physical	16965536
AHK3_ARATH	HK3	physical	16965536
ARR14_ARATH	RR14	physical	16965536
ARR5_ARATH	RR5	physical	16965536
ARR7_ARATH	ARR7	physical	16965536
ARR16_ARATH	RR16	physical	16965536

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AHP1_ARATH

Related Literatures of Post-Translational Modification