UniProt ID | ARR2_ARATH | |
---|---|---|
UniProt AC | Q9ZWJ9 | |
Protein Name | Two-component response regulator ARR2 | |
Gene Name | ARR2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 664 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway.. | |
Protein Sequence | MVNPGHGRGPDSGTAAGGSNSDPFPANLRVLVVDDDPTCLMILERMLMTCLYRVTKCNRAESALSLLRKNKNGFDIVISDVHMPDMDGFKLLEHVGLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRIEALKNIWQHVVRKKRNEWNVSEHSGGSIEDTGGDRDRQQQHREDADNNSSSVNEGNGRSSRKRKEEEVDDQGDDKEDSSSLKKPRVVWSVELHQQFVAAVNQLGVDKAVPKKILEMMNVPGLTRENVASHLQKYRIYLRRLGGVSQHQGNMNHSFMTGQDQSFGPLSSLNGFDLQSLAVTGQLPPQSLAQLQAAGLGRPTLAKPGMSVSPLVDQRSIFNFENPKIRFGDGHGQTMNNGNLLHGVPTGSHMRLRPGQNVQSSGMMLPVADQLPRGGPSMLPSLGQQPILSSSVSRRSDLTGALAVRNSIPETNSRVLPTTHSVFNNFPADLPRSSFPLASAPGISVPVSVSYQEEVNSSDAKGGSSAATAGFGNPSYDIFNDFPQHQQHNKNISNKLNDWDLRNMGLVFSSNQDAATATATAAFSTSEAYSSSSTQRKRRETDATVVGEHGQNLQSPSRNLYHLNHVFMDGGSVRVKSERVAETVTCPPANTLFHEQYNQEDLMSAFLKQEGIPSVDNEFEFDGYSIDNIQV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
80 | Phosphorylation | GFDIVISDVHMPDMD CCCEEEECCCCCCCC | 24.18 | 15282545 | |
340 | Phosphorylation | TLAKPGMSVSPLVDQ CCCCCCCCCCCCCCC | 25.92 | 30407730 | |
342 | Phosphorylation | AKPGMSVSPLVDQRS CCCCCCCCCCCCCHH | 12.76 | 30407730 | |
446 | Phosphorylation | NSIPETNSRVLPTTH CCCCCCCCCCCCCCH | 31.05 | 19880383 | |
588 | Phosphorylation | EHGQNLQSPSRNLYH CCCCCCCCCCCCEEE | 28.19 | 23111157 | |
590 | Phosphorylation | GQNLQSPSRNLYHLN CCCCCCCCCCEEECC | 38.76 | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARR2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARR2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARR2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AHP3_ARATH | AHP3 | physical | 18642946 | |
AHP2_ARATH | AHP2 | physical | 18642946 | |
AHP1_ARATH | AHP1 | physical | 18642946 | |
HMT1_ARATH | HMT-1 | physical | 18642946 | |
GSTUB_ARATH | GSTU11 | physical | 18642946 | |
14335_ARATH | GRF5 | physical | 18642946 | |
AHP1_ARATH | AHP1 | physical | 11370868 | |
AHP2_ARATH | AHP2 | physical | 11370868 | |
AHP1_ARATH | AHP1 | physical | 16965536 | |
AHP2_ARATH | AHP2 | physical | 16965536 | |
AHP3_ARATH | AHP3 | physical | 16965536 | |
AHP4_ARATH | AHP4 | physical | 16965536 | |
AHP5_ARATH | AHP5 | physical | 16965536 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...