dbPTM

AHP5_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AHP5_ARATH
UniProt AC	Q8L9T7
Protein Name	Histidine-containing phosphotransfer protein 5
Gene Name	AHP5
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	157
Subcellular Localization	Cytoplasm, cytosol . Nucleus .
Protein Description	Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay..
Protein Sequence	MNTIVVAQLQRQFQDYIVSLYQQGFLDNQFSELRKLQDEGTPDFVAEVVSLFFDDCSKLINTMSISLERPDNVDFKQVDSGVHQLKGSSSSVGARRVKNVCISFKECCDVQNREGCLRCLQQVDYEYKMLKTKLQDLFNLEKQILQAGGTIPQVDIN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
1	Acetylation	-------MNTIVVAQ -------CCCHHHHH	10.09	-
83	Phosphorylation	KQVDSGVHQLKGSSS HHCCCCCHHCCCCCC	30.68	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AHP5_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AHP5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AHP5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYC2_ARATH	MYC2	physical	12826627
ARR4_ARATH	ARR4	physical	18642946
ARR1_ARATH	RR1	physical	18642946
RH41_ARATH	AT3G02065	physical	18642946
UPS1_ARATH	UPS1	physical	22737156
AHK4_ARATH	WOL	physical	16965536
ARR1_ARATH	RR1	physical	16965536
ARR2_ARATH	RR2	physical	16965536
ARR22_ARATH	RR22	physical	16965536
AHK2_ARATH	HK2	physical	16965536
ARR11_ARATH	ARR11	physical	16965536
ARR3_ARATH	ARR3	physical	16965536
ARR4_ARATH	ARR4	physical	16965536
ARR5_ARATH	RR5	physical	16965536
ARR6_ARATH	ARR6	physical	16965536
ARR7_ARATH	ARR7	physical	16965536
ARR8_ARATH	RR3	physical	16965536
ARR9_ARATH	ARR9	physical	16965536
ARR15_ARATH	ARR15	physical	16965536
ARR16_ARATH	RR16	physical	16965536

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AHP5_ARATH

Related Literatures of Post-Translational Modification