ARR6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARR6_ARATH
• UniProt AC: Q9ZWS6
• Protein Name: Two-component response regulator ARR6
• Gene Name: ARR6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 186
• Subcellular Localization: Nucleus .
• Protein Description: Functions as response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling..
• Protein Sequence: MAEVMLPRKMEILNHSSKFGSPDPLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGLDVEEKSVGFEDLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAEDFLLKPVKLSDVKRLRDSLMKVEDLSFTKSIQKRELETENVYPVHSQLKRAKI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
86	Phosphorylation	KVNLIMTDYSMPGMT EEEEEEECCCCCCCC	19.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARR6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARR6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARR6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AZF3_ARATH	ZF3	physical	18642946
GTE7_ARATH	GTE7	physical	18642946
LSH1_ARATH	LSH1	physical	18642946

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.