ARR22_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARR22_ARATH
• UniProt AC: Q9M8Y4
• Protein Name: Two-component response regulator ARR22
• Gene Name: ARR22
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 142
• Subcellular Localization: Nucleus .
• Protein Description: Functions as response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling (By similarity)..
• Protein Sequence: MATKSTGGTEKTKSIEVKKKLINVLIVDDDPLNRRLHEMIIKTIGGISQTAKNGEEAVILHRDGEASFDLILMDKEMPERDGVSTTKKLREMKVTSMIVGVTSVADQEEERKAFMEAGLNHCLEKPLTKAKIFPLISHLFDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
74	Phosphorylation	SFDLILMDKEMPERD EEEEEEECCCCCCCC	40.08	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARR22_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARR22_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARR22_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AHP2_ARATH	AHP2	physical	18625081
AHP3_ARATH	AHP3	physical	18625081
AHP5_ARATH	AHP5	physical	18625081
AHP5_ARATH	AHP5	physical	16965536

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.