| UniProt ID | AHP4_ARATH | |
|---|---|---|
| UniProt AC | Q9LU15 | |
| Protein Name | Histidine-containing phosphotransfer protein 4 | |
| Gene Name | AHP4 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 127 | |
| Subcellular Localization | Cytoplasm, cytosol. Nucleus. | |
| Protein Description | Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay.. | |
| Protein Sequence | MTNIGKCMQGYLDEQFMELEELQDDANPNFVEEVSALYFKDSARLINNIDQALERGSFDFNRLDSYMHQFKGSSTSIGASKVKAECTTFREYCRAGNAEGCLRTFQQLKKEHSTLRKKLEHYFQASQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 68 | Phosphorylation | NRLDSYMHQFKGSST HHHHHHHHHCCCCCC | 22.99 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AHP4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AHP4_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AHP4_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARR1_ARATH | RR1 | physical | 16965536 | |
| ARR2_ARATH | RR2 | physical | 16965536 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...