AHP4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AHP4_ARATH
• UniProt AC: Q9LU15
• Protein Name: Histidine-containing phosphotransfer protein 4
• Gene Name: AHP4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 127
• Subcellular Localization: Cytoplasm, cytosol. Nucleus.
• Protein Description: Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay..
• Protein Sequence: MTNIGKCMQGYLDEQFMELEELQDDANPNFVEEVSALYFKDSARLINNIDQALERGSFDFNRLDSYMHQFKGSSTSIGASKVKAECTTFREYCRAGNAEGCLRTFQQLKKEHSTLRKKLEHYFQASQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
68	Phosphorylation	NRLDSYMHQFKGSST HHHHHHHHHCCCCCC	22.99	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AHP4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AHP4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AHP4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARR1_ARATH	RR1	physical	16965536
ARR2_ARATH	RR2	physical	16965536

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.