UniProt ID | YO387_YEAST | |
---|---|---|
UniProt AC | Q08910 | |
Protein Name | VEL1-related protein YOR387C | |
Gene Name | YOR387C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 206 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | ||
Protein Sequence | MSFLNIFTFFSVLVSVATAVRFDLTNVTCNNLHGPHCGTYVMEVVGQNGTFLGQSTFAGADVLTESAGDAWARYLGQETRFLPKLTTIASNDTKNFSPLIFTTNIYTCNPQSIGDAMVPFANTVTGEIEYNSWADTADNASFITGLANQLFNSTQYGVQVASCYPNFASVILSTPTVNIFAANETLPDYCTAIQLKAVCPPDAGFA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | N-linked_Glycosylation | AVRFDLTNVTCNNLH HHHCCCCCCCCCCCC | 34.10 | - | |
48 | N-linked_Glycosylation | VMEVVGQNGTFLGQS EEEEECCCCCCCCCC | 45.61 | - | |
91 | N-linked_Glycosylation | KLTTIASNDTKNFSP CEEEECCCCCCCCCC | 52.53 | - | |
139 | N-linked_Glycosylation | SWADTADNASFITGL CCCCCCCHHHHHHHH | 34.71 | - | |
152 | N-linked_Glycosylation | GLANQLFNSTQYGVQ HHHHHHHCCCCCCEE | 53.38 | - | |
183 | N-linked_Glycosylation | TVNIFAANETLPDYC CEEEEECCCCCCCCE | 39.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO387_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO387_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO387_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPB1_YEAST | RPO21 | genetic | 27708008 | |
CAB5_YEAST | CAB5 | genetic | 27708008 | |
GPI11_YEAST | GPI11 | genetic | 27708008 | |
GPI8_YEAST | GPI8 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
MCE1_YEAST | CEG1 | genetic | 27708008 | |
FDFT_YEAST | ERG9 | genetic | 27708008 | |
SN114_YEAST | SNU114 | genetic | 27708008 | |
GSP1_YEAST | GSP1 | genetic | 27708008 | |
LST8_YEAST | LST8 | genetic | 27708008 | |
SIF2_YEAST | SIF2 | genetic | 27708008 | |
ILM1_YEAST | ILM1 | genetic | 27708008 | |
RL8B_YEAST | RPL8B | genetic | 27708008 | |
GAS1_YEAST | GAS1 | genetic | 27708008 | |
YND5_YEAST | YNL035C | genetic | 27708008 | |
SWS2_YEAST | SWS2 | genetic | 27708008 | |
YN8H_YEAST | YNR029C | genetic | 27708008 | |
PSH1_YEAST | PSH1 | genetic | 27708008 | |
MET22_YEAST | MET22 | genetic | 27708008 | |
ECM3_YEAST | ECM3 | genetic | 27708008 | |
ATG29_YEAST | ATG29 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...