| UniProt ID | YL161_YEAST | |
|---|---|---|
| UniProt AC | P0CE98 | |
| Protein Name | Putative uncharacterized protein YLR161W | |
| Gene Name | YLR161W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 114 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCMRPANQEIYPLRHCETLRSQPCSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YL161_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL161_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL161_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL161_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCPZ_YEAST | CCT6 | genetic | 27708008 | |
| IPYR_YEAST | IPP1 | genetic | 27708008 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| TECR_YEAST | TSC13 | genetic | 27708008 | |
| SUB2_YEAST | SUB2 | genetic | 27708008 | |
| RPN6_YEAST | RPN6 | genetic | 27708008 | |
| DPOD_YEAST | POL3 | genetic | 27708008 | |
| UAP1_YEAST | QRI1 | genetic | 27708008 | |
| KIN28_YEAST | KIN28 | genetic | 27708008 | |
| RRP42_YEAST | RRP42 | genetic | 27708008 | |
| CDC48_YEAST | CDC48 | genetic | 27708008 | |
| CDC53_YEAST | CDC53 | genetic | 27708008 | |
| RPB1_YEAST | RPO21 | genetic | 27708008 | |
| TCPD_YEAST | CCT4 | genetic | 27708008 | |
| COPA_YEAST | COP1 | genetic | 27708008 | |
| RPN5_YEAST | RPN5 | genetic | 27708008 | |
| NOP14_YEAST | NOP14 | genetic | 27708008 | |
| DNLI1_YEAST | CDC9 | genetic | 27708008 | |
| GLE1_YEAST | GLE1 | genetic | 27708008 | |
| LCB2_YEAST | LCB2 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| SYMC_YEAST | MES1 | genetic | 27708008 | |
| CDC12_YEAST | CDC12 | genetic | 27708008 | |
| DPOD2_YEAST | POL31 | genetic | 27708008 | |
| FIP1_YEAST | FIP1 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 | |
| DYR_YEAST | DFR1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...