UniProt ID | YL156_YEAST | |
---|---|---|
UniProt AC | P0CE96 | |
Protein Name | Putative uncharacterized protein YLR156W | |
Gene Name | YLR156W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 114 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCMRPANQEIYPLRHCETLRSQPCSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YL156_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL156_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL156_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL156_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TCPZ_YEAST | CCT6 | genetic | 27708008 | |
IPYR_YEAST | IPP1 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
TECR_YEAST | TSC13 | genetic | 27708008 | |
SUB2_YEAST | SUB2 | genetic | 27708008 | |
RPN6_YEAST | RPN6 | genetic | 27708008 | |
DPOD_YEAST | POL3 | genetic | 27708008 | |
UAP1_YEAST | QRI1 | genetic | 27708008 | |
KIN28_YEAST | KIN28 | genetic | 27708008 | |
RRP42_YEAST | RRP42 | genetic | 27708008 | |
CDC48_YEAST | CDC48 | genetic | 27708008 | |
CDC53_YEAST | CDC53 | genetic | 27708008 | |
RPB1_YEAST | RPO21 | genetic | 27708008 | |
TCPD_YEAST | CCT4 | genetic | 27708008 | |
COPA_YEAST | COP1 | genetic | 27708008 | |
RPN5_YEAST | RPN5 | genetic | 27708008 | |
NOP14_YEAST | NOP14 | genetic | 27708008 | |
DNLI1_YEAST | CDC9 | genetic | 27708008 | |
GLE1_YEAST | GLE1 | genetic | 27708008 | |
LCB2_YEAST | LCB2 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
SYMC_YEAST | MES1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
DPOD2_YEAST | POL31 | genetic | 27708008 | |
FIP1_YEAST | FIP1 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
DYR_YEAST | DFR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...