UniProt ID | YG258_YEAST | |
---|---|---|
UniProt AC | Q3E740 | |
Protein Name | Uncharacterized protein YGL258W-A | |
Gene Name | YGL258W-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 77 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAYNTLDSNSRIIITVQSVAILDGKLVW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YG258_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YG258_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YG258_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YG258_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MED8_YEAST | MED8 | genetic | 27708008 | |
SUB2_YEAST | SUB2 | genetic | 27708008 | |
GPI11_YEAST | GPI11 | genetic | 27708008 | |
TSC11_YEAST | TSC11 | genetic | 27708008 | |
ZPR1_YEAST | ZPR1 | genetic | 27708008 | |
GWT1_YEAST | GWT1 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
DPOA_YEAST | POL1 | genetic | 27708008 | |
SEC23_YEAST | SEC23 | genetic | 27708008 | |
RFS1_YEAST | RFS1 | genetic | 27708008 | |
SERB_YEAST | SER2 | genetic | 27708008 | |
VPS53_YEAST | VPS53 | genetic | 27708008 | |
CSN12_YEAST | YJR084W | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
ROM2_YEAST | ROM2 | genetic | 27708008 | |
TSA1_YEAST | TSA1 | genetic | 27708008 | |
YNO0_YEAST | YNL140C | genetic | 27708008 | |
DIA2_YEAST | DIA2 | genetic | 27708008 | |
PDE2_YEAST | PDE2 | genetic | 27708008 | |
VPS4_YEAST | VPS4 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...