UniProt ID | YFH7_SCHPO | |
---|---|---|
UniProt AC | O42845 | |
Protein Name | Uncharacterized RING finger protein C23A1.07 | |
Gene Name | SPAC23A1.07 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 251 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MIESELATSRWSLMLEADIATQTTRSLTNELSFIVAGLRPSTKESVLHFLELIFINLKYQSKKWLYSLVICKSLIALLGRKRLSANVRKIVRFLNVIICVIGLWKGLSAMSGKNTFINGLQSYLISETALPELGSFQELSTSSLGSFRMFQQIAVGFVDALFCTRIPASLWIKYKEYTTSAETTVPQECGLCMMCVQRGDERVAITTPYTTDCGHTYCYACIMSRLKLVNNVSCPICKHRIRFALPDQTMG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YFH7_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YFH7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YFH7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YFH7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ASE1_SCHPO | ase1 | genetic | 18818364 | |
MUB1_SCHPO | SPBC31F10.10c | genetic | 18818364 | |
SSU72_SCHPO | ssu72 | genetic | 18818364 | |
RSV2_SCHPO | rsv2 | genetic | 18818364 | |
H2AZ_SCHPO | pht1 | genetic | 18818364 | |
AMO1_SCHPO | amo1 | genetic | 18818364 | |
TEA2_SCHPO | tea2 | genetic | 18818364 | |
ASK1_SCHPO | ask1 | genetic | 18818364 | |
VPS71_SCHPO | vps71 | genetic | 18818364 | |
RSC1_SCHPO | rsc1 | genetic | 18818364 | |
CCR4_SCHPO | ccr4 | genetic | 18818364 | |
VPH2_SCHPO | vph2 | genetic | 18818364 | |
RAF2_SCHPO | raf2 | genetic | 18818364 | |
YNU4_SCHPO | SPBC28E12.04 | genetic | 22681890 | |
YFPC_SCHPO | SPAC7D4.12c | genetic | 22681890 | |
YAC5_SCHPO | cph1 | genetic | 22681890 | |
MUG33_SCHPO | mug33 | genetic | 22681890 | |
HOB3_SCHPO | hob3 | genetic | 22681890 | |
RIA1_SCHPO | ria1 | genetic | 22681890 | |
PDS5_SCHPO | pds5 | genetic | 22681890 | |
ERD11_SCHPO | erd1 | genetic | 22681890 | |
RS4B_SCHPO | rps402 | genetic | 22681890 | |
YOM1_SCHPO | SPBPB7E8.01 | genetic | 22681890 | |
MAD1_SCHPO | mad1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...