UniProt ID | WFDC2_HUMAN | |
---|---|---|
UniProt AC | Q14508 | |
Protein Name | WAP four-disulfide core domain protein 2 | |
Gene Name | WFDC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 124 | |
Subcellular Localization | Secreted . | |
Protein Description | Broad range protease inhibitor.. | |
Protein Sequence | MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | N-linked_Glycosylation | PELQADQNCTQECVS CHHCCCCCCCHHCCC | 31.20 | 16740002 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WFDC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WFDC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WFDC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTN_HUMAN | PTN | physical | 16169070 | |
WDR81_HUMAN | WDR81 | physical | 28514442 | |
PDIA5_HUMAN | PDIA5 | physical | 28514442 | |
WDR91_HUMAN | WDR91 | physical | 28514442 | |
CRAC1_HUMAN | CRTAC1 | physical | 28514442 | |
PTPRF_HUMAN | PTPRF | physical | 28514442 | |
EMC4_HUMAN | EMC4 | physical | 28514442 | |
IF1AX_HUMAN | EIF1AX | physical | 28514442 | |
GRN_HUMAN | GRN | physical | 28514442 | |
FKBP7_HUMAN | FKBP7 | physical | 28514442 | |
BTBD1_HUMAN | BTBD1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Identification of N-linked glycoproteins in human saliva byglycoprotein capture and mass spectrometry."; Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T.,Loo J.A.; J. Proteome Res. 5:1493-1503(2006). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-44, AND MASS SPECTROMETRY. |