UniProt ID | TSSK6_HUMAN | |
---|---|---|
UniProt AC | Q9BXA6 | |
Protein Name | Testis-specific serine/threonine-protein kinase 6 | |
Gene Name | TSSK6 {ECO:0000312|EMBL:AAH14611.1} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 273 | |
Subcellular Localization | ||
Protein Description | Required for sperm production and function. Plays a role in DNA condensation during postmeiotic chromatin remodeling (By similarity).. | |
Protein Sequence | MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MSGDKLLSELGYKLG CCHHHHHHHHHHHHC | 41.01 | 30622161 | |
22 | Phosphorylation | GRTIGEGSYSKVKVA CCCCCCCCCCEEEEE | 23.18 | 30622161 | |
23 | Phosphorylation | RTIGEGSYSKVKVAT CCCCCCCCCEEEEEE | 24.30 | 30622161 | |
24 | Phosphorylation | TIGEGSYSKVKVATS CCCCCCCCEEEEEEC | 32.44 | 30622161 | |
251 | Phosphorylation | IAELLQFSPSARPSA HHHHHHCCCCCCCCH | 12.65 | 30622161 | |
253 | Phosphorylation | ELLQFSPSARPSAGQ HHHHCCCCCCCCHHH | 35.39 | 30622161 | |
257 | Phosphorylation | FSPSARPSAGQVARN CCCCCCCCHHHHHHH | 39.21 | 30622161 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSSK6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSSK6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSSK6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MBP_HUMAN | MBP | physical | 15870294 | |
HS90A_HUMAN | HSP90AA1 | physical | 15870294 | |
HSP7C_HUMAN | HSPA8 | physical | 15870294 | |
HSP74_HUMAN | HSPA4 | physical | 15870294 | |
H2A2C_HUMAN | HIST2H2AC | physical | 15870294 | |
H31_HUMAN | HIST1H3A | physical | 15870294 | |
H2AX_HUMAN | H2AFX | physical | 15870294 | |
H12_BOVIN | HIST1H1C | physical | 15870294 | |
A4_HUMAN | APP | physical | 21832049 | |
TCPB_HUMAN | CCT2 | physical | 25852190 | |
TCPG_HUMAN | CCT3 | physical | 25852190 | |
TCPD_HUMAN | CCT4 | physical | 25852190 | |
TCPE_HUMAN | CCT5 | physical | 25852190 | |
TCPZ_HUMAN | CCT6A | physical | 25852190 | |
TCPH_HUMAN | CCT7 | physical | 25852190 | |
TCPQ_HUMAN | CCT8 | physical | 25852190 | |
FKBP5_HUMAN | FKBP5 | physical | 25852190 | |
TCPA_HUMAN | TCP1 | physical | 25852190 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...