| UniProt ID | TM129_HUMAN | |
|---|---|---|
| UniProt AC | A0AVI4 | |
| Protein Name | E3 ubiquitin-protein ligase TM129 | |
| Gene Name | TMEM129 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 362 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | E3 ubiquitin-protein ligase involved in ER-associated protein degradation, preferentially associates with the E2 enzyme UBE2J2. Exploited by viral US11 proteins to mediate HLA class I proteins degradation.. | |
| Protein Sequence | MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMCLAASEKRLHALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQAVASSVNTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQLLTIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLVEVNPAYSVPSSQELEACIGCMQTRASVKLVKTCQEAATGECQQCYCRPMWCLTCMGKWFASRQDPLRPDTWLASRVPCPTCRARFCILDVCTVR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 81 | Ubiquitination | MCLAASEKRLHALSQ HHHHHHHHHHHHHHC | 58.74 | 22817900 | |
| 154 | Ubiquitination | TEFRRIDKFATGAPG CCHHHHHHHCCCCCC | 34.23 | 22817900 | |
| 154 (in isoform 1) | Ubiquitination | - | 34.23 | 21906983 | |
| 154 (in isoform 2) | Ubiquitination | - | 34.23 | 21906983 | |
| 167 | Phosphorylation | PGARVIVTDTWVMKV CCCEEEEECCEEEEE | 19.31 | - | |
| 169 | Phosphorylation | ARVIVTDTWVMKVTT CEEEEECCEEEEEEE | 15.59 | - | |
| 190 | Phosphorylation | QQQDVHLTVTESRQH ECCEEEEEEECCCCC | 15.54 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM129_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM129_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM129_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PSMD4_HUMAN | PSMD4 | physical | 24807418 | |
| UB2D3_HUMAN | UBE2D3 | physical | 24807418 | |
| UB2J2_HUMAN | UBE2J2 | physical | 24807418 | |
| DERL1_HUMAN | DERL1 | physical | 24807418 | |
| DERL2_HUMAN | DERL2 | physical | 24807418 | |
| SELS_HUMAN | VIMP | physical | 24807418 | |
| TERA_HUMAN | VCP | physical | 24807418 | |
| SE1L1_HUMAN | SEL1L | physical | 24807418 | |
| SYVN1_HUMAN | SYVN1 | physical | 24807418 | |
| 1A02_HUMAN | HLA-A | physical | 24807418 | |
| 1A03_HUMAN | HLA-A | physical | 24807418 | |
| 1A01_HUMAN | HLA-A | physical | 24807418 | |
| 1A26_HUMAN | HLA-A | physical | 24807418 | |
| TM129_HUMAN | TMEM129 | physical | 25030448 | |
| UB2D1_HUMAN | UBE2D1 | physical | 25030448 | |
| DERL1_HUMAN | DERL1 | physical | 25030448 | |
| 1A02_HUMAN | HLA-A | physical | 25030448 | |
| 1A03_HUMAN | HLA-A | physical | 25030448 | |
| 1A01_HUMAN | HLA-A | physical | 25030448 | |
| 1A26_HUMAN | HLA-A | physical | 25030448 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
