UniProt ID | TCL1A_HUMAN | |
---|---|---|
UniProt AC | P56279 | |
Protein Name | T-cell leukemia/lymphoma protein 1A | |
Gene Name | TCL1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 114 | |
Subcellular Localization | Cytoplasm. Nucleus. Microsome . Endoplasmic reticulum . Microsomal fraction. | |
Protein Description | Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.. | |
Protein Sequence | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Phosphorylation | VVLGRPMTPTQIGPS EECCCCCCCCCCCCC | 26.35 | 30301811 | |
65 | Phosphorylation | LGRPMTPTQIGPSLL CCCCCCCCCCCCCHH | 24.53 | 30301811 | |
70 | Phosphorylation | TPTQIGPSLLPIMWQ CCCCCCCCHHHHEEE | 37.01 | 30301811 | |
96 | Phosphorylation | SSFWRLVYHIKIDGV CCCHHHEEEEEECCH | 11.47 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCL1A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCL1A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCL1A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
H2A3_HUMAN | HIST3H2A | physical | 16189514 | |
CACO2_HUMAN | CALCOCO2 | physical | 16189514 | |
AKT1_HUMAN | AKT1 | physical | 11707444 | |
AKT2_HUMAN | AKT2 | physical | 11707444 | |
AKT3_HUMAN | AKT3 | physical | 11707444 | |
TCL1A_HUMAN | TCL1A | physical | 10983986 | |
AKT1_HUMAN | AKT1 | physical | 12009899 | |
ATM_HUMAN | ATM | physical | 22065599 | |
EP300_HUMAN | EP300 | physical | 19064921 | |
JUN_HUMAN | JUN | physical | 19064921 | |
TCL1A_HUMAN | TCL1A | physical | 25416956 | |
CAPS1_HUMAN | CADPS | physical | 25416956 | |
CACO2_HUMAN | CALCOCO2 | physical | 25416956 | |
WDR47_HUMAN | WDR47 | physical | 25416956 | |
TTC33_HUMAN | TTC33 | physical | 25416956 | |
LSM3_HUMAN | LSM3 | physical | 25416956 | |
CEP55_HUMAN | CEP55 | physical | 25416956 | |
PRDC1_HUMAN | PRTFDC1 | physical | 25416956 | |
CARD9_HUMAN | CARD9 | physical | 25416956 | |
AL2SB_HUMAN | ALS2CR12 | physical | 25416956 | |
TXLNB_HUMAN | TXLNB | physical | 25416956 | |
TXLNA_HUMAN | TXLNA | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...