ST4A1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ST4A1_HUMAN
• UniProt AC: Q9BR01
• Protein Name: Sulfotransferase 4A1
• Gene Name: SULT4A1
• Organism: Homo sapiens (Human).
• Sequence Length: 284
• Subcellular Localization: Cytoplasm.
• Protein Description: Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS..
• Protein Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MAESEAETPST ----CCCCCCCCCCC	32.35	27732954
8	Phosphorylation	MAESEAETPSTPGEF CCCCCCCCCCCCCCH	29.59	27732954
10	Phosphorylation	ESEAETPSTPGEFES CCCCCCCCCCCCHHH	55.44	27732954
11	Phosphorylation	SEAETPSTPGEFESK CCCCCCCCCCCHHHC	36.19	27732954
19	Phosphorylation	PGEFESKYFEFHGVR CCCHHHCCEEECCCC	20.02	27196784
53	Phosphorylation	SDVWIVTYPKSGTSL HHEEEEEECCCCCHH	9.58	-
142	Phosphorylation	PKDLVVSYYQFHRSL HHHEEEEEHHHHHHH	6.95	22817900
155	Methylation	SLRTMSYRGTFQEFC HHHHCCCCCHHHHHH	30.30	115388357
205	Phosphorylation	DMHRDLVTMVEQLAR HHHHHHHHHHHHHHH	23.85	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
11	T	Phosphorylation	Kinase	MAPK3	P27361	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ST4A1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ST4A1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DPH2_HUMAN	DPH2	physical	26186194
AN13C_HUMAN	ANKRD13C	physical	26186194
DPH1_HUMAN	DPH1	physical	26186194
PARVG_HUMAN	PARVG	physical	28514442
ST1A1_HUMAN	SULT1A1	physical	28514442
ERMIN_HUMAN	ERMN	physical	28514442
ST1A3_HUMAN	SULT1A3	physical	28514442
ST1A4_HUMAN	SULT1A3	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.