UniProt ID | ERMIN_HUMAN | |
---|---|---|
UniProt AC | Q8TAM6 | |
Protein Name | Ermin | |
Gene Name | ERMN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 284 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia maturation, myelin/Ranvier node formation during CNS development, and in the maintenance and plasticity of related structures in the mature CNS (By similarity).. | |
Protein Sequence | MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 (in isoform 2) | Phosphorylation | - | 43.00 | 26270265 | |
5 (in isoform 2) | Phosphorylation | - | 28.52 | 26270265 | |
54 | Phosphorylation | PSLEGALTKGSQEER CCHHCCCCCCCHHHH | 32.59 | 25247763 | |
72 | Phosphorylation | QGNMLLNSSMEDKML HHHHHHCCHHHHHHH | 30.91 | 29507054 | |
73 | Phosphorylation | GNMLLNSSMEDKMLK HHHHHCCHHHHHHHH | 25.72 | 29507054 | |
80 | Acetylation | SMEDKMLKENPEEKL HHHHHHHHHCHHHCE | 52.53 | 19810435 | |
95 | Phosphorylation | FIVHKAITDLSLQET EEEHHHHCCCCCCCC | 35.43 | 29523821 | |
98 | Phosphorylation | HKAITDLSLQETSAD HHHHCCCCCCCCCCC | 30.71 | 29523821 | |
102 | Phosphorylation | TDLSLQETSADEMTF CCCCCCCCCCCCCCC | 19.09 | 29083192 | |
103 | Phosphorylation | DLSLQETSADEMTFR CCCCCCCCCCCCCCC | 32.73 | 29083192 | |
108 | Phosphorylation | ETSADEMTFREGHQW CCCCCCCCCCCCCCC | 19.93 | 29083192 | |
123 | Phosphorylation | EKIPLSGSNQEIRRQ EECCCCCCHHHHHHH | 31.78 | 24076635 | |
166 | Phosphorylation | WLGFRKPSQADMLHS ECCCCCHHHHHHHCC | 40.82 | 28555341 | |
173 | Phosphorylation | SQADMLHSKHDEEQK HHHHHHCCCCCHHHH | 27.94 | 28555341 | |
179 | Phosphorylation | HSKHDEEQKVWDEEI CCCCCHHHHHHCCCC | 43.48 | 27251275 | |
214 | Phosphorylation | KKKHEEVSQFKEEGD HHHHHHHHHHHHCCC | 32.93 | - | |
226 | Phosphorylation | EGDASEDSPLSSASS CCCCCCCCCCCCCCC | 24.56 | - | |
230 | Phosphorylation | SEDSPLSSASSQAVT CCCCCCCCCCCCCCC | 39.59 | - | |
233 | Phosphorylation | SPLSSASSQAVTPDE CCCCCCCCCCCCCCC | 23.13 | - | |
237 | Phosphorylation | SASSQAVTPDEQPTL CCCCCCCCCCCCCCC | 28.21 | - | |
255 | Phosphorylation | SDISRNAYSRYNTIS CCCCCCHHHHCCCCC | 9.38 | 21712546 | |
256 | Phosphorylation | DISRNAYSRYNTISY CCCCCHHHHCCCCCC | 26.36 | 21712546 | |
260 | Phosphorylation | NAYSRYNTISYRKIR CHHHHCCCCCCEECC | 11.45 | 20886841 | |
262 | Phosphorylation | YSRYNTISYRKIRKG HHHCCCCCCEECCCC | 19.49 | 25332170 | |
263 | Phosphorylation | SRYNTISYRKIRKGN HHCCCCCCEECCCCC | 16.45 | 21712546 | |
271 | Phosphorylation | RKIRKGNTKQRIDEF EECCCCCCCCCHHHH | 36.90 | 26270265 | |
280 | Phosphorylation | QRIDEFESMMHL--- CCHHHHHHHHCC--- | 27.08 | 23401153 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERMIN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERMIN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERMIN_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...