UniProt ID | PARVG_HUMAN | |
---|---|---|
UniProt AC | Q9HBI0 | |
Protein Name | Gamma-parvin | |
Gene Name | PARVG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 331 | |
Subcellular Localization |
Cell junction, focal adhesion. Cell membrane Peripheral membrane protein Cytoplasmic side. Cytoplasm, cytoskeleton. Constituent of focal adhesions.. |
|
Protein Description | Probably plays a role in the regulation of cell adhesion and cytoskeleton organization.. | |
Protein Sequence | MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEPEFLYD -------CCHHHHHH | 20.48 | 25944712 | |
7 | Phosphorylation | -MEPEFLYDLLQLPK -CCHHHHHHHHCCCC | 15.18 | 28464451 | |
29 | Ubiquitination | EELSKGGKKKYLPPT HHHHCCCCCCCCCCC | 55.55 | - | |
31 | Ubiquitination | LSKGGKKKYLPPTSR HHCCCCCCCCCCCCC | 56.35 | - | |
42 | Ubiquitination | PTSRKDPKFEELQKV CCCCCCCCHHHHHHH | 75.45 | - | |
103 | Ubiquitination | ALTATSQKHKLTVVL EEEECCCCHHHHHHH | 42.34 | - | |
178 | Ubiquitination | KSGLKSEKLVEQLTE CCCCCHHHHHHHHHH | 65.99 | - | |
190 | Ubiquitination | LTEYSTDKDEPPKDV HHHHCCCCCCCCCHH | 65.17 | - | |
203 | Ubiquitination | DVFDELFKLAPEKVN HHHHHHHHHCHHHHH | 57.26 | - | |
208 | Acetylation | LFKLAPEKVNAVKEA HHHHCHHHHHHHHHH | 39.47 | 25953088 | |
208 | Ubiquitination | LFKLAPEKVNAVKEA HHHHCHHHHHHHHHH | 39.47 | - | |
213 | Ubiquitination | PEKVNAVKEAIVNFV HHHHHHHHHHHHHHH | 38.73 | 21890473 | |
213 | Acetylation | PEKVNAVKEAIVNFV HHHHHHHHHHHHHHH | 38.73 | 7364705 | |
213 (in isoform 1) | Ubiquitination | - | 38.73 | 21890473 | |
213 (in isoform 2) | Ubiquitination | - | 38.73 | 21890473 | |
300 | Ubiquitination | SPEDIVNKDAKSTLR CHHHHCCCCHHHHHH | 48.44 | - | |
325 | Phosphorylation | QKAHRDRTPHGAPN- HHHHHCCCCCCCCC- | 24.75 | 28787133 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PARVG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PARVG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PARVG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
ZN677_HUMAN | ZNF677 | physical | 21988832 | |
USBP1_HUMAN | USHBP1 | physical | 25416956 | |
KLH32_HUMAN | KLHL32 | physical | 25416956 | |
RSU1_HUMAN | RSU1 | physical | 26186194 | |
LIMS1_HUMAN | LIMS1 | physical | 26186194 | |
ILK_HUMAN | ILK | physical | 26186194 | |
POLK_HUMAN | POLK | physical | 26186194 | |
AASD1_HUMAN | AARSD1 | physical | 26186194 | |
ILK_HUMAN | ILK | physical | 28514442 | |
RSU1_HUMAN | RSU1 | physical | 28514442 | |
LIMS1_HUMAN | LIMS1 | physical | 28514442 | |
POLK_HUMAN | POLK | physical | 28514442 | |
AASD1_HUMAN | AARSD1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...