UniProt ID | SSBP3_MOUSE | |
---|---|---|
UniProt AC | Q9D032 | |
Protein Name | Single-stranded DNA-binding protein 3 | |
Gene Name | Ssbp3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 388 | |
Subcellular Localization | Nucleus. | |
Protein Description | May be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.. | |
Protein Sequence | MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MFAKGKGS -------CCCCCCCC | 7.13 | - | |
155 | Asymmetric dimethylarginine | SQPFMSPRYAGGPRP CCCCCCCCCCCCCCC | 26.99 | - | |
155 | Methylation | SQPFMSPRYAGGPRP CCCCCCCCCCCCCCC | 26.99 | - | |
161 | Methylation | PRYAGGPRPPIRMGN CCCCCCCCCCCCCCC | 53.56 | 24129315 | |
161 | Asymmetric dimethylarginine | PRYAGGPRPPIRMGN CCCCCCCCCCCCCCC | 53.56 | - | |
165 | Asymmetric dimethylarginine | GGPRPPIRMGNQPPG CCCCCCCCCCCCCCC | 32.50 | - | |
165 | Methylation | GGPRPPIRMGNQPPG CCCCCCCCCCCCCCC | 32.50 | 24129315 | |
347 | Phosphorylation | IDGLPKNSPNNISGI CCCCCCCCCCCCCCC | 34.82 | 25521595 | |
352 | Phosphorylation | KNSPNNISGISNPPG CCCCCCCCCCCCCCC | 32.00 | 24925903 | |
355 | Phosphorylation | PNNISGISNPPGTPR CCCCCCCCCCCCCCC | 46.97 | 24925903 | |
360 | Phosphorylation | GISNPPGTPRDDGEL CCCCCCCCCCCCCCC | 22.41 | 25521595 | |
374 | Phosphorylation | LGGNFLHSFQNDNYS CCHHHHHHHCCCCCC | 30.58 | 25619855 | |
380 | Phosphorylation | HSFQNDNYSPSMTMS HHHCCCCCCCCCEEC | 25.48 | 25619855 | |
381 | Phosphorylation | SFQNDNYSPSMTMSV HHCCCCCCCCCEECC | 19.43 | 25619855 | |
383 | Phosphorylation | QNDNYSPSMTMSV-- CCCCCCCCCEECC-- | 22.42 | 25619855 | |
385 | Phosphorylation | DNYSPSMTMSV---- CCCCCCCEECC---- | 15.61 | 25619855 | |
387 | Phosphorylation | YSPSMTMSV------ CCCCCEECC------ | 18.60 | 25619855 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
360 | T | Phosphorylation | Kinase | MAPK1 | P63085 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSBP3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSBP3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAI14_MOUSE | Rai14 | physical | 20211142 | |
KDM4C_MOUSE | Kdm4c | physical | 20211142 | |
CERS2_MOUSE | Cers2 | physical | 20211142 | |
PWP1_MOUSE | Pwp1 | physical | 20211142 | |
ISL2_MOUSE | Isl2 | physical | 20211142 | |
SLF1_MOUSE | Ankrd32 | physical | 20211142 | |
TLE6_MOUSE | Tle6 | physical | 20211142 | |
ZSWM4_MOUSE | Zswim4 | physical | 20211142 | |
MED16_MOUSE | Med16 | physical | 20211142 | |
ZN592_MOUSE | Zfp592 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...