UniProt ID | SNX24_HUMAN | |
---|---|---|
UniProt AC | Q9Y343 | |
Protein Name | Sorting nexin-24 | |
Gene Name | SNX24 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 169 | |
Subcellular Localization |
Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side. |
|
Protein Description | May be involved in several stages of intracellular trafficking.. | |
Protein Sequence | MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEVYIPSF -------CCEECCCC | 7.68 | 22814378 | |
13 | Phosphorylation | PSFRYEESDLERGYT CCCCCCHHHHCCCEE | 35.24 | 29759185 | |
19 | Phosphorylation | ESDLERGYTVFKIEV HHHHCCCEEEEEEEE | 13.12 | 29759185 | |
20 | Phosphorylation | SDLERGYTVFKIEVL HHHCCCEEEEEEEEE | 23.45 | 29759185 | |
40 | Phosphorylation | HFVEKRYSEFHALHK HHHHHHHHHHHHHHH | 37.51 | 27251275 | |
42 | Ubiquitination | VEKRYSEFHALHKKL HHHHHHHHHHHHHHH | 3.16 | 23000965 | |
60 | Phosphorylation | IKTPEIPSKHVRNWV HCCCCCCCHHHHHHH | 40.84 | 24719451 | |
69 | Ubiquitination | HVRNWVPKVLEQRRQ HHHHHHHHHHHHHHH | 50.24 | 23000965 | |
102 | Ubiquitination | LFLDFLNVRHLPSLP HHHHHHCCCCCCCCC | 4.42 | 23000965 | |
113 | Phosphorylation | PSLPKAESCGSFDET CCCCCCHHCCCCCCC | 28.74 | 23927012 | |
116 | Phosphorylation | PKAESCGSFDETESE CCCHHCCCCCCCCCH | 33.57 | 30278072 | |
120 | Phosphorylation | SCGSFDETESEESSK HCCCCCCCCCHHHHC | 46.81 | 23927012 | |
122 | Phosphorylation | GSFDETESEESSKLS CCCCCCCCHHHHCCC | 54.83 | 23403867 | |
125 | Phosphorylation | DETESEESSKLSHQP CCCCCHHHHCCCCCC | 28.81 | 23403867 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNX24_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNX24_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNX24_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
1433Z_HUMAN | YWHAZ | physical | 21900206 | |
SEPT2_HUMAN | SEPT2 | physical | 22863883 | |
FLNC_HUMAN | FLNC | physical | 26186194 | |
KPTN_HUMAN | KPTN | physical | 26186194 | |
ITFG2_HUMAN | ITFG2 | physical | 26186194 | |
UGPA_HUMAN | UGP2 | physical | 26186194 | |
GDS1_HUMAN | RAP1GDS1 | physical | 26186194 | |
KC1A_HUMAN | CSNK1A1 | physical | 28514442 | |
GAPD1_HUMAN | GAPVD1 | physical | 28514442 | |
LONF2_HUMAN | LONRF2 | physical | 28514442 | |
SNX22_HUMAN | SNX22 | physical | 28514442 | |
UGPA_HUMAN | UGP2 | physical | 28514442 | |
PACS1_HUMAN | PACS1 | physical | 28514442 | |
AF9_HUMAN | MLLT3 | physical | 28514442 | |
FBP1L_HUMAN | FNBP1L | physical | 28514442 | |
PHOCN_HUMAN | MOB4 | physical | 28514442 | |
HINT1_HUMAN | HINT1 | physical | 28514442 | |
STRN_HUMAN | STRN | physical | 28514442 | |
1433G_HUMAN | YWHAG | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-116, AND MASSSPECTROMETRY. |