dbPTM

SNX22_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SNX22_HUMAN
UniProt AC	Q96L94
Protein Name	Sorting nexin-22
Gene Name	SNX22
Organism	Homo sapiens (Human).
Sequence Length	193
Subcellular Localization	Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side.
Protein Description	May be involved in several stages of intracellular trafficking (By similarity). Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P))..
Protein Sequence	MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVLSFHVDPYVCNPSPESLPNVVVNGVLQGLYSFSISPDKAQPKAACHPAPLPPMP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MLEVHIPSVGPEAEG CCEEECCCCCCCCCC	38.82	28348404
19	Phosphorylation	EAEGPRQSPEKSHMV CCCCCCCCCCCCCEE	35.98	22496350
34	Phosphorylation	FRVEVLCSGRRHTVP EEEEEEECCCCCCCC	31.04	24719451
45	Phosphorylation	HTVPRRYSEFHALHK CCCCHHHHHHHHHHH	31.79	27251275
92	Phosphorylation	AYIQGILYLNQEVPK HHHHHHHHCCCCCCH	11.16	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SNX22_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SNX22_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SNX22_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SNX22_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SNX22_HUMAN

Related Literatures of Post-Translational Modification