SMAD5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMAD5_MOUSE
• UniProt AC: P97454
• Protein Name: Mothers against decapentaplegic homolog 5
• Gene Name: Smad5
• Organism: Mus musculus (Mouse).
• Sequence Length: 465
• Subcellular Localization: Cytoplasm. Nucleus. In the cytoplasm in the absence of ligand. Migration to the nucleus when complexed with SMAD4 (By similarity)..
• Protein Description: Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD) (By similarity). Required for angiogenesis..
• Protein Sequence: MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNAPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMAPDNSQPMDTSSNMIPQTMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTSMASLFS ------CCCHHHHHH	27.49	-
11	Phosphorylation	MASLFSFTSPAVKRL HHHHHHCCCHHHHHH	32.38	28066266
12	Phosphorylation	ASLFSFTSPAVKRLL HHHHHCCCHHHHHHH	14.62	28066266
71	Phosphorylation	KCVTIPRSLDGRLQV CEEECCCCCCCCEEE	26.00	20139300
79	Phosphorylation	LDGRLQVSHRKGLPH CCCCEEEECCCCCCE	12.47	25338131
89	Phosphorylation	KGLPHVIYCRVWRWP CCCCEEEEEEEEECC	3.52	29514104
133	Phosphorylation	YHYKRVESPVLPPVL CCCCCCCCCCCCCEE	19.90	26824392
243	Phosphorylation	DNSQPMDTSSNMIPQ CCCCCCCCCCCCCCC	28.01	-
321	Phosphorylation	LSNVNRNSTIENTRR HCCCCCCCCCHHHHH	27.76	30635358
322	Phosphorylation	SNVNRNSTIENTRRH CCCCCCCCCHHHHHH	35.54	23684622
326	Phosphorylation	RNSTIENTRRHIGKG CCCCCHHHHHHCCCC	19.11	23684622
452	Phosphorylation	QWLDKVLTQMGSPLN HHHHHHHHHCCCCCC	21.35	23737553
456	Phosphorylation	KVLTQMGSPLNPISS HHHHHCCCCCCCCCC	22.37	23737553
462	Phosphorylation	GSPLNPISSVS---- CCCCCCCCCCC----	26.41	23737553
463	Phosphorylation	SPLNPISSVS----- CCCCCCCCCC-----	27.40	26824392
465	Phosphorylation	LNPISSVS------- CCCCCCCC-------	36.13	26824392

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Smurf1	Q9CUN6	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMAD5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMAD5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZEB2_MOUSE	Zeb2	physical	20211142
SUV92_MOUSE	Suv39h2	physical	15107829
ERCC3_MOUSE	Ercc3	physical	16101586
BACH1_MOUSE	Bach1	physical	16101586
KLF10_MOUSE	Klf10	physical	16101586
PRS6A_MOUSE	Psmc3	physical	16101586
SMAD9_MOUSE	Smad9	physical	16101586
CXB6_MOUSE	Gjb6	physical	16101586
MXI1_MOUSE	Mxi1	physical	16101586
MEN1_MOUSE	Men1	physical	15150273

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.