| UniProt ID | SINAL_DROME | |
|---|---|---|
| UniProt AC | Q8T3Y0 | |
| Protein Name | Probable E3 ubiquitin-protein ligase sinah | |
| Gene Name | sinah | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 351 | |
| Subcellular Localization | ||
| Protein Description | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. The adapter phyl is required to direct the degradation of the two isoforms of the transcriptional repressor Tramtrack (Ttk). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates. A phyl-independent mechanism of degradation exists for isoform beta of ttk that involves motifs in the C-terminus of ttk.. | |
| Protein Sequence | MSVRNSRPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPSRRKDSVAVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENFSSFTNADFLVLNKHTVELFSEDGNLALNVVIRKVEERTN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SINAL_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SINAL_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SINAL_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SINAL_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TTKB_DROME | ttk | physical | 14605208 | |
| TTKA_DROME | ttk | physical | 14605208 | |
| RAD54_DROME | okr | physical | 14605208 | |
| CNN_DROME | cnn | physical | 14605208 | |
| SDHF4_DROME | Sirup | physical | 14605208 | |
| 1433Z_DROME | 14-3-3zeta | physical | 14605208 | |
| SMCO4_DROME | CG33169 | physical | 14605208 | |
| CCNB_DROME | CycB | physical | 14605208 | |
| MTA70_DROME | Ime4 | physical | 14605208 | |
| SLOU_DROME | slou | physical | 14605208 | |
| RL18_DROME | RpL18 | physical | 14605208 | |
| RS18_DROME | RpS18 | physical | 14605208 | |
| ADT_DROME | sesB | physical | 14605208 | |
| HSP75_DROME | Hsp70Bb | physical | 14605208 | |
| HSP73_DROME | Hsp70Bb | physical | 14605208 | |
| HSP71_DROME | Hsp70Ab | physical | 14605208 | |
| HSP70_DROME | Hsp70Ab | physical | 14605208 | |
| HSP72_DROME | Hsp70Ba | physical | 14605208 | |
| HSP74_DROME | Hsp70Bbb | physical | 14605208 | |
| EBI_DROME | ebi | physical | 17561381 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
