UniProt ID | SDHF4_DROME | |
---|---|---|
UniProt AC | Q9VLU6 | |
Protein Name | Succinate dehydrogenase assembly factor 4, mitochondrial {ECO:0000303|PubMed:24954416} | |
Gene Name | Sirup {ECO:0000312|FlyBase:FBgn0031971} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 118 | |
Subcellular Localization | Mitochondrion matrix . | |
Protein Description | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. [PubMed: 24954416 Binds to the flavoprotein subunit SdhA in its FAD-bound form, blocking the generation of excess reactive oxigen species (ROS) and facilitating its assembly with the iron-sulfur protein subunit SdhB into the SDH catalytic dimer (By similarity] | |
Protein Sequence | MQSVTRQTARVLPQMGKQVSYLSTSGAWRATASGGDMVVEIKEPKTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SDHF4_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDHF4_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDHF4_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDHF4_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SINA_DROME | sina | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...