UniProt ID | RBL2A_HUMAN | |
---|---|---|
UniProt AC | Q9UBK7 | |
Protein Name | Rab-like protein 2A | |
Gene Name | RABL2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 228 | |
Subcellular Localization | ||
Protein Description | Plays an essential role in male fertility, sperm intra-flagellar transport, and tail assembly. Binds, in a GTP-regulated manner, to a specific set of effector proteins including key proteins involved in cilia development and function and delivers them into the growing sperm tail.. | |
Protein Sequence | MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEVASPHS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Acetylation | YDADDNVKIICLGDS CCCCCCEEEEEECCC | 32.38 | 20167786 | |
23 | Ubiquitination | YDADDNVKIICLGDS CCCCCCEEEEEECCC | 32.38 | - | |
26 | S-nitrosylation | DDNVKIICLGDSAVG CCCEEEEEECCCHHC | 3.86 | 24105792 | |
30 | Phosphorylation | KIICLGDSAVGKSKL EEEEECCCHHCHHHH | 24.05 | 30622161 | |
34 | Acetylation | LGDSAVGKSKLMERF ECCCHHCHHHHHHHH | 37.51 | 20167786 | |
34 (in isoform 3) | Ubiquitination | - | 37.51 | - | |
34 | Ubiquitination | LGDSAVGKSKLMERF ECCCHHCHHHHHHHH | 37.51 | - | |
35 | Acetylation | GDSAVGKSKLMERFL CCCHHCHHHHHHHHH | 25.70 | - | |
36 (in isoform 3) | Ubiquitination | - | 56.17 | - | |
52 | Phosphorylation | GFQPQQLSTYALTLY CCCHHHHHHHHHEEE | 18.29 | - | |
57 | Phosphorylation | QLSTYALTLYKHTAT HHHHHHHEEEEEEEE | 21.62 | - | |
59 | Phosphorylation | STYALTLYKHTATVD HHHHHEEEEEEEEEC | 8.76 | - | |
85 | Phosphorylation | AGQERFQSMHASYYH HCHHHHHHHHHHHHH | 15.15 | 23663014 | |
89 | Phosphorylation | RFQSMHASYYHKAHA HHHHHHHHHHHHCCE | 16.14 | 23663014 | |
90 | Phosphorylation | FQSMHASYYHKAHAC HHHHHHHHHHHCCEE | 15.46 | 23663014 | |
91 | Phosphorylation | QSMHASYYHKAHACI HHHHHHHHHHCCEEE | 8.37 | 23663014 | |
141 | Phosphorylation | KIDDINVTQKSFNFA CCCCCCCCHHHCCHH | 26.28 | 20058876 | |
143 | Ubiquitination | DDINVTQKSFNFAKK CCCCCCHHHCCHHHH | 47.88 | - | |
144 (in isoform 2) | Ubiquitination | - | 18.66 | 21890473 | |
144 | Phosphorylation | DINVTQKSFNFAKKF CCCCCHHHCCHHHHC | 18.66 | - | |
149 | Ubiquitination | QKSFNFAKKFSLPLY HHHCCHHHHCCCCEE | 50.65 | - | |
149 (in isoform 3) | Ubiquitination | - | 50.65 | - | |
150 | Ubiquitination | KSFNFAKKFSLPLYF HHCCHHHHCCCCEEE | 36.43 | - | |
150 | Ubiquitination | KSFNFAKKFSLPLYF HHCCHHHHCCCCEEE | 36.43 | 21890473 | |
150 (in isoform 1) | Ubiquitination | - | 36.43 | 21890473 | |
150 (in isoform 3) | Ubiquitination | - | 36.43 | - | |
151 (in isoform 2) | Ubiquitination | - | 10.00 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RBL2A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBL2A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBL2A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SMC5_HUMAN | SMC5 | physical | 22939629 | |
SPTN1_HUMAN | SPTAN1 | physical | 22939629 | |
SPTB2_HUMAN | SPTBN1 | physical | 22939629 | |
SLK_HUMAN | SLK | physical | 22939629 | |
TBC9B_HUMAN | TBC1D9B | physical | 22939629 | |
CEP19_HUMAN | CEP19 | physical | 25416956 | |
AKA11_HUMAN | AKAP11 | physical | 26186194 | |
VP13A_HUMAN | VPS13A | physical | 26186194 | |
ALMS1_HUMAN | ALMS1 | physical | 26186194 | |
MTO1_HUMAN | MTO1 | physical | 26186194 | |
BRCA2_HUMAN | BRCA2 | physical | 26186194 | |
DPOLA_HUMAN | POLA1 | physical | 26186194 | |
P73_HUMAN | TP73 | physical | 26186194 | |
TTF2_HUMAN | TTF2 | physical | 26186194 | |
FIGL1_HUMAN | FIGNL1 | physical | 28514442 | |
FHIT_HUMAN | FHIT | physical | 28514442 | |
ALMS1_HUMAN | ALMS1 | physical | 28514442 | |
S23IP_HUMAN | SEC23IP | physical | 28514442 | |
MTO1_HUMAN | MTO1 | physical | 28514442 | |
BRCA2_HUMAN | BRCA2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...