UniProt ID | RB27C_DROME | |
---|---|---|
UniProt AC | P48809 | |
Protein Name | Heterogeneous nuclear ribonucleoprotein 27C | |
Gene Name | Hrb27C | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 421 | |
Subcellular Localization | Nucleus. Cytoplasm. Nuclear and/or cytoplasmic. | |
Protein Description | This protein is a component of ribonucleosomes. Could be needed to organize a concentration gradient of a dorsalizing morphogen (Dm) originating in the germinal vesicle.. | |
Protein Sequence | MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRDGSGGQNSNNSTVGGAYGKLGNECSHWGPHHAPINMMQGQNGQMGGPPLNMPIGAPNMMPGYQGWGTSPQQQQYGYGNSGPGSYQGWGAPPGPQGPPPQWSNYAGPQQTQGYGGYDMYNSTSTGAPSGPSGGGSWNSWNMPPNSAGPTGAPGAGAGTATDMYSRAQAWATGGPSTTGPVGGMPRTGPGNSASKSGSEYDYGGYGSGYDYDYSNYVKQEGASNYGAGPRSAYGNDSSTQPPYATSQAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
177 | Phosphorylation | KAEPRDGSGGQNSNN ECCCCCCCCCCCCCC | 44.00 | 22817900 | |
182 | Phosphorylation | DGSGGQNSNNSTVGG CCCCCCCCCCCCCCC | 29.51 | 19429919 | |
185 | Phosphorylation | GGQNSNNSTVGGAYG CCCCCCCCCCCCCHH | 28.81 | 19429919 | |
186 | Phosphorylation | GQNSNNSTVGGAYGK CCCCCCCCCCCCHHC | 25.87 | 19429919 | |
191 | Phosphorylation | NSTVGGAYGKLGNEC CCCCCCCHHCCCCCC | 20.33 | 18281928 | |
348 | Phosphorylation | AWATGGPSTTGPVGG HHHCCCCCCCCCCCC | 41.71 | 21082442 | |
359 | Phosphorylation | PVGGMPRTGPGNSAS CCCCCCCCCCCCCCC | 41.69 | 21082442 | |
364 | Phosphorylation | PRTGPGNSASKSGSE CCCCCCCCCCCCCCC | 39.57 | 19429919 | |
366 | Phosphorylation | TGPGNSASKSGSEYD CCCCCCCCCCCCCCC | 27.46 | 19429919 | |
368 | Phosphorylation | PGNSASKSGSEYDYG CCCCCCCCCCCCCCC | 45.09 | 19429919 | |
370 | Phosphorylation | NSASKSGSEYDYGGY CCCCCCCCCCCCCCC | 39.82 | 19429919 | |
372 | Phosphorylation | ASKSGSEYDYGGYGS CCCCCCCCCCCCCCC | 19.03 | 22817900 | |
374 | Phosphorylation | KSGSEYDYGGYGSGY CCCCCCCCCCCCCCC | 16.14 | 20450229 | |
377 | Phosphorylation | SEYDYGGYGSGYDYD CCCCCCCCCCCCCCC | 12.07 | 20450229 | |
379 | Phosphorylation | YDYGGYGSGYDYDYS CCCCCCCCCCCCCHH | 26.20 | 19429919 | |
397 | Phosphorylation | KQEGASNYGAGPRSA CCCCCCCCCCCCCCC | 13.07 | 25749252 | |
403 | Phosphorylation | NYGAGPRSAYGNDSS CCCCCCCCCCCCCCC | 29.04 | 19429919 | |
405 | Phosphorylation | GAGPRSAYGNDSSTQ CCCCCCCCCCCCCCC | 20.08 | 19429919 | |
415 | Phosphorylation | DSSTQPPYATSQAV- CCCCCCCCCCCCCC- | 29.24 | 18281928 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB27C_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB27C_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB27C_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RB97D_DROME | Rb97D | physical | 14605208 | |
Y2199_DROME | CG2199 | physical | 14605208 | |
K10_DROME | fs(1)K10 | physical | 14605208 | |
CTBP_DROME | CtBP | physical | 14605208 | |
PROML_DROME | prominin-like | physical | 14605208 | |
FER_DROME | FER | physical | 14605208 | |
OTU_DROME | otu | genetic | 15056611 | |
CUP_DROME | cup | physical | 18082158 | |
GRK_DROME | grk | physical | 15056611 | |
PABP_DROME | pAbp | physical | 18082158 | |
OSKA_DROME | osk | physical | 15056611 | |
ROA1_DROME | Hrb98DE | physical | 26545814 | |
RB87F_DROME | Hrb87F | physical | 26545814 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-177; SER-366; SER-368;SER-370; TYR-372 AND SER-379, AND MASS SPECTROMETRY. |