RB97D_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RB97D_DROME
• UniProt AC: Q02926
• Protein Name: Ribonucleoprotein RB97D
• Gene Name: Rb97D
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 471
• Protein Description: Required for spermatogenesis. Could be required to process a specific transcript essential for spermatogenesis..
• Protein Sequence: MVKDEPLSDESADVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPGAQQWHANQWGCPPPVQQVPPVGAVPPPMGHNGPPPTAPGNWNMPPPVPGAAPPSHQQQSSQQPTPQPNFGTGYQQNYGGGPSKHNNMNANRMNPYSAGPPNSYHTPQPPAYTGYNAGPLPPNGSVPPPTGAKAVGVSNGSVATGGSANSKYRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MVKDEPLSDESADVI CCCCCCCCCCCCCEE	50.47	19429919
11	Phosphorylation	DEPLSDESADVIVLA CCCCCCCCCCEEEEC	34.46	19429919
468	Acetylation	TGGSANSKYRR---- CCCCCCCCCCC----	42.45	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RB97D_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RB97D_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RB97D_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.