dbPTM

PUS6_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PUS6_YEAST
UniProt AC	P53294
Protein Name	tRNA pseudouridine(31) synthase
Gene Name	PUS6
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	404
Subcellular Localization	Cytoplasm . Mitochondrion .
Protein Description	Catalyzes the formation of pseudouridine at position 31 in the psi GC loop of tRNAS..
Protein Sequence	MSTIKVIEVYTQNGLRKVRPYYNRRSAFVKGRWLGKLLIDVLVSEFKLRPRAYYLDQIRKGTYRLIRDGVPLVPDHLMTTIIKNHDVLETTTHKHEPPVKQWCSQEVEAEDLPGRIAGFNIVFEDESILVIDKPSGIPVHPTGQFYQNTITELLKLHGVDALPCYRLDKITSGLLILAKNSQSAGEIQKSIRSRDMIKIYLARVKGRFPHSELILDNENAAETTFEDTSKVTVEMTPIYSIDPKRQFPVGLSTSKDAITKFYPIRYFSHADETVVACKPITGRTHQIRIHLARLGHPIVNDSVYCSHITKYPERLKFITQFPRWENQQDLDAEELKVRFQKFVDETKNNCRTMETFCPECHTVDLKDPVLSDLELWLHAWKYEEINGKFKFKTDLPKWAQLDNS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
260	Acetylation	TSKDAITKFYPIRYF CCHHHHHHCCEEEEE	36.47	24489116
273	Phosphorylation	YFSHADETVVACKPI EEECCCCEEEEEEEC	22.34	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PUS6_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PUS6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PUS6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELP2_YEAST	ELP2	genetic	19061648
UTP4_YEAST	UTP4	genetic	19061648
UTP18_YEAST	UTP18	genetic	19061648
MAK11_YEAST	MAK11	genetic	19061648
NTR2_YEAST	NTR2	genetic	19061648
CGR1_YEAST	CGR1	genetic	27708008
ICE2_YEAST	ICE2	genetic	27708008
RAD10_YEAST	RAD10	genetic	27708008
VAM3_YEAST	VAM3	genetic	27708008
PEX19_YEAST	PEX19	genetic	27708008
DHAS_YEAST	HOM2	genetic	27708008
RT103_YEAST	RTT103	genetic	27708008
AK_YEAST	HOM3	genetic	27708008
YIF4_YEAST	YIL054W	genetic	27708008
RL17B_YEAST	RPL17B	genetic	27708008
RL22A_YEAST	RPL22A	genetic	27708008
SST2_YEAST	SST2	genetic	27708008
RTG1_YEAST	RTG1	genetic	27708008
SFL1_YEAST	SFL1	genetic	27708008
KAR3_YEAST	KAR3	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PUS6_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-273, AND MASSSPECTROMETRY.	18407956 [Abstract]